Property Summary

Ligand Count 6
NCBI Gene PubMed Count 66
PubMed Score 142.08
PubTator Score 99.26

Knowledge Summary

Patent (16,353)

TINX Plot

  Disease (5)

Expression

  Differential Expression (7)

 GWAS Trait (1)

Gene RIF (39)

AA Sequence

MRTLLPPALLTCWLLAPVNSIHPECRFHLEIQEEETKCAELLRSQTEKHKACSGVWDNITCWRPANVGET      1 - 70
VTVPCPKVFSNFYSKAGNISKNCTSDGWSETFPDFVDACGYSDPEDESKITFYILVKAIYTLGYSVSLMS     71 - 140
LATGSIILCLFRKLHCTRNYIHLNLFLSFILRAISVLVKDDVLYSSSGTLHCPDQPSSWVGCKLSLVFLQ    141 - 210
YCIMANFFWLLVEGLYLHTLLVAMLPPRRCFLAYLLIGWGLPTVCIGAWTAARLYLEDTGCWDTNDHSVP    211 - 280
WWVIRIPILISIIVNFVLFISIIRILLQKLTSPDVGGNDQSQYKRLAKSTLLLIPLFGVHYMVFAVFPIS    281 - 350
ISSKYQILFELCLGSFQGLVVAVLYCFLNSEVQCELKRKWRSRCPTPSASRDYRVCGSSFSRNGSEGALQ    351 - 420
FHRGSRAQSFLQTETSVI                                                        421 - 438
//

Text Mined References (69)

PMID Year Title