Property Summary

NCBI Gene PubMed Count 64
Grant Count 32
R01 Count 13
Funding $2,701,922.9
PubMed Score 136.46
PubTator Score 99.26

Knowledge Summary

Patent (16,353)

Expression

 GWAS Trait (1)

Gene RIF (37)

PMID Text
26881970 The results reveal that more severe inflammation, based on high levels of IL-6, is associated with lower expression of VPAC1 and, conversely, with increased expression of VPAC2.
26304033 Lower CpG methylation of VIPR2 in the saliva of children with ADHD.
24827637 Monocytes from Sjogren's syndrome patients display increased vasoactive intestinal peptide receptor 2 expression and impaired apoptotic cell phagocytosis.
24794882 This study suggest that carriers of microduplication genotypes of VIPR2 are predisposed to SCZ in Han Chinese.
24469917 CD4+ T cells in HIV infection show increased levels of expression of VPAC2
23818986 Data indicate that VIP and PACAP increased macrophage resistance to HIV-1 replication by inducing the synthesis of beta-chemokines CCL3 and CCL5 and IL-10 following preferential activation of the receptors VPAC2 and PAC1.
23637909 This is the first study to suggest a role of VIPR2 in the genetic susceptibility to high myopia. EGR1, JUN, FOS and VIP are unlikely to be important in predisposing humans to high myopia.
23073313 Genetic testing for VIPR2-LCR-associated inversions should be performed on available cohorts of psychiatric patients to evaluate their potential pathogenic role
22961270 Conclude that VPAC2/PAC1 receptors require NO in series to effect cutaneous active vasodilation during heat stress in humans.
22886412 PACAP causes PAC1/VPAC2 receptor mediated hypertension and sympathoexcitation in normal and hypertensive rats.
More...

AA Sequence

MRTLLPPALLTCWLLAPVNSIHPECRFHLEIQEEETKCAELLRSQTEKHKACSGVWDNITCWRPANVGET      1 - 70
VTVPCPKVFSNFYSKAGNISKNCTSDGWSETFPDFVDACGYSDPEDESKITFYILVKAIYTLGYSVSLMS     71 - 140
LATGSIILCLFRKLHCTRNYIHLNLFLSFILRAISVLVKDDVLYSSSGTLHCPDQPSSWVGCKLSLVFLQ    141 - 210
YCIMANFFWLLVEGLYLHTLLVAMLPPRRCFLAYLLIGWGLPTVCIGAWTAARLYLEDTGCWDTNDHSVP    211 - 280
WWVIRIPILISIIVNFVLFISIIRILLQKLTSPDVGGNDQSQYKRLAKSTLLLIPLFGVHYMVFAVFPIS    281 - 350
ISSKYQILFELCLGSFQGLVVAVLYCFLNSEVQCELKRKWRSRCPTPSASRDYRVCGSSFSRNGSEGALQ    351 - 420
FHRGSRAQSFLQTETSVI                                                        421 - 438
//

Publication (67)

PMID Year Title
26881970 2016 Clinical Relevance of VPAC1 Receptor Expression in Early Arthritis: Association with IL-6 and Disease Activity.
26304033 2016 Methylomic analysis of salivary DNA in childhood ADHD identifies altered DNA methylation in VIPR2.
24827637 2014 Monocytes from Sjögren's syndrome patients display increased vasoactive intestinal peptide receptor 2 expression and impaired apoptotic cell phagocytosis.
24794882 2014 A competitive PCR assay confirms the association of a copy number variation in the VIPR2 gene with schizophrenia in Han Chinese.
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
24469917 2014 CD4+ T cells in HIV infection show increased levels of expression of a receptor for vasoactive intestinal peptide, VPAC2.
23818986 2013 Macrophage Resistance to HIV-1 Infection Is Enhanced by the Neuropeptides VIP and PACAP.
23637909 2013 Genetic susceptibility to refractive error: association of vasoactive intestinal peptide receptor 2 (VIPR2) with high myopia in Chinese.
23406873 2013 A genome-wide meta-analysis identifies two novel loci associated with high myopia in the Han Chinese population.
23073313 2013 Low-copy repeats at the human VIPR2 gene predispose to recurrent and nonrecurrent rearrangements.
More...