Property Summary

NCBI Gene PubMed Count 72
PubMed Score 81.37
PubTator Score 168.00

Knowledge Summary

Patent (19,732)

TINX Plot

  Disease Sources (4)

Disease Target Count
Asthma 349
Disease Target Count P-value
psoriasis 6685 1.09434610530588E-53
sonic hedgehog group medulloblastoma 1482 1.58330142570321E-6
medulloblastoma, large-cell 6234 8.0538783701888E-6
atypical teratoid / rhabdoid tumor 4369 2.85595256331585E-5
ovarian cancer 8492 6.56398596685641E-5
ductal carcinoma in situ 1745 9.73349618014899E-5
invasive ductal carcinoma 2950 1.32908876496406E-4
oligodendroglioma 2849 3.09948003366217E-4
ependymoma 2514 4.91521837854816E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00190150758390974
astrocytic glioma 2241 0.00346845207759272
subependymal giant cell astrocytoma 2287 0.0283943136350107
Disease Target Count Z-score Confidence
Mental depression 58 0.0 2.0
Disease Target Count Z-score Confidence
post-traumatic stress disorder 45 4.983 2.5

Expression

Synonym

Accession P41586 A8K1Y1 B7ZLA7 B8ZZK3 Q17S10 PACAP type I receptor
Symbols PAC1
PAC1R
PACAPR
PACAPRI

Gene

PDB

2JOD   3N94  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (44)

PMID Text
26343289 Data show that glucocorticoid response genes NR3C1, ADCYAP1R1 and HSD11B2 were relatively hypomethylated whereas FKBP5 was hypermethylated.
26334183 Further investigations of genetic factors for trauma-related psychopathology should include careful assessments of the social environment
25918834 High child stress and an ADCYAP1R1 single-nucleotide polymorphism are associated with reduced bronchodilator response in children with asthma.
25680674 Rsults suggest that impaired contextual conditioning in the hippocampal formation may mediate the association between type I receptor of the pituitary adenylate cyclase activating polypeptideand and posttraumatic stress disorder symptoms.
24696141 PAC1/PACAP receptor endocytosis contributes to ERK acktivation.
24516127 Individual differences in ADCYAP1R1 genotype may contribute to dysregulated fear circuitry known to play a central role in posttraumatic stress disorder and other anxiety disorders.
24220567 This review focuses on role of PAC1 receptor in brain development, behavior of transgenic animals and potential implication in human neurodevelopmental disorders.
23981011 association of variants with sudden infant death not supported
23972788 and its receptor (PAC1) are involved in stress response and anxiety.
23818986 Data indicate that VIP and PACAP increased macrophage resistance to HIV-1 replication by inducing the synthesis of beta-chemokines CCL3 and CCL5 and IL-10 following preferential activation of the receptors VPAC2 and PAC1.
More...

AA Sequence

MAGVVHVSLAALLLLPMAPAMHSDCIFKKEQAMCLEKIQRANELMGFNDSSPGCPGMWDNITCWKPAHVG      1 - 70
EMVLVSCPELFRIFNPDQVWETETIGESDFGDSNSLDLSDMGVVSRNCTEDGWSEPFPHYFDACGFDEYE     71 - 140
SETGDQDYYYLSVKALYTVGYSTSLVTLTTAMVILCRFRKLHCTRNFIHMNLFVSFMLRAISVFIKDWIL    141 - 210
YAEQDSNHCFISTVECKAVMVFFHYCVVSNYFWLFIEGLYLFTLLVETFFPERRYFYWYTIIGWGTPTVC    211 - 280
VTVWATLRLYFDDTGCWDMNDSTALWWVIKGPVVGSIMVNFVLFIGIIVILVQKLQSPDMGGNESSIYLR    281 - 350
LARSTLLLIPLFGIHYTVFAFSPENVSKRERLVFELGLGSFQGFVVAVLYCFLNGEVQAEIKRKWRSWKV    351 - 420
NRYFAVDFKHRHPSLASSGVNGGTQLSILSKSSSQIRMSGLPADNLAT                          421 - 468
//

Text Mined References (75)

PMID Year Title
26343289 2015 Placental epigenetic patterning of glucocorticoid response genes is associated with infant neurodevelopment.
26334183 2015 Gene-by-social-environment interaction (GxSE) between ADCYAP1R1 genotype and neighborhood crime predicts major depression symptoms in trauma-exposed women.
25918834 2015 Stress and Bronchodilator Response in Children with Asthma.
25680674 2015 Neural Mechanism of a Sex-Specific Risk Variant for Posttraumatic Stress Disorder in the Type I Receptor of the Pituitary Adenylate Cyclase Activating Polypeptide.
25147783 2014 Genetic Associations with Plasma B12, B6, and Folate Levels in an Ischemic Stroke Population from the Vitamin Intervention for Stroke Prevention (VISP) Trial.
24696141 2014 PACAP-induced ERK activation in HEK cells expressing PAC1 receptors involves both receptor internalization and PKC signaling.
24516127 2014 PACAP receptor gene polymorphism impacts fear responses in the amygdala and hippocampus.
24220567 2013 PACAP and PAC1 receptor in brain development and behavior.
23981011 2013 Analysis of PAC1 receptor gene variants in Caucasian and African American infants dying of sudden infant death syndrome.
23972788 2013 Genetic polymorphisms in the PACAP and PAC1 receptor genes and treatment response to venlafaxine XR in generalized anxiety disorder.
More...