Property Summary

NCBI Gene PubMed Count 21
PubMed Score 118.54
PubTator Score 112.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
adult high grade glioma -2.000 2.4e-06
Astrocytoma, Pilocytic -1.700 1.8e-08
atypical teratoid / rhabdoid tumor -2.700 5.1e-08
Breast cancer -1.800 1.5e-34
colon cancer -1.500 2.1e-03
ductal carcinoma in situ -1.100 2.0e-04
ependymoma -1.700 4.0e-02
glioblastoma -1.900 3.0e-09
intraductal papillary-mucinous neoplasm ... -1.300 7.0e-03
invasive ductal carcinoma -1.430 1.7e-02
lung cancer -1.200 3.1e-03
medulloblastoma -1.200 3.1e-05
medulloblastoma, large-cell -1.900 4.2e-06
Multiple myeloma 1.051 1.9e-02
non-small cell lung cancer -1.878 6.6e-30
osteosarcoma -1.212 3.1e-02
ovarian cancer -2.500 1.2e-08
primitive neuroectodermal tumor -1.100 4.1e-02
psoriasis -1.200 4.0e-03
pterygium -1.100 2.8e-03
Rheumatoid arthritis 1.100 2.7e-02
sarcoidosis -1.200 1.6e-02
spina bifida -1.200 4.3e-02
subependymal giant cell astrocytoma -1.099 1.5e-02
tuberculosis 1.300 1.5e-04

Synonym

Accession P41567 Q9UNQ9 eIF1
Symbols A121
ISO1
SUI1
EIF-1
EIF1A

Gene

PDB

2IF1   4KZX   4KZY  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Component (2)

Gene RIF (7)

AA Sequence

MSAIQNLHSFDPFADASKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACN      1 - 70
GTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF                                71 - 113
//

Text Mined References (25)

PMID Year Title