Property Summary

NCBI Gene PubMed Count 19
PubMed Score 111.26
PubTator Score 112.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
Breast cancer 3099 1.45535213156991E-34
non-small cell lung cancer 2798 6.61410684165245E-30
ependymoma 2514 4.8454351824805E-11
pilocytic astrocytoma 3086 6.40842695162764E-9
ovarian cancer 8492 1.21425227535872E-8
atypical teratoid / rhabdoid tumor 4369 5.10040042604308E-8
pediatric high grade glioma 2712 2.87863975453925E-7
medulloblastoma, large-cell 6234 4.24211601910867E-6
glioblastoma 5572 1.02982136125082E-5
medulloblastoma 1524 3.14640749883011E-5
tuberculosis 1563 1.52684947292764E-4
ductal carcinoma in situ 1745 1.98119766949954E-4
colon cancer 1475 0.00213189680596705
pterygium 74 0.00282328702140099
psoriasis 6685 0.00397790380795647
invasive ductal carcinoma 2950 0.00503560652722248
subependymal giant cell astrocytoma 2287 0.00601141479489843
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00700793971635052
sarcoidosis 368 0.0162675482944839
Multiple myeloma 1328 0.0180718954371892
Rheumatoid Arthritis 1171 0.026699649992449
osteosarcoma 7933 0.0308151318053703
primitive neuroectodermal tumor 3031 0.0405164397400758
spina bifida 1064 0.0431282910081447
lung cancer 4473 0.0437340710870564
Disease Target Count Z-score Confidence
Vestibular neuronitis 5 3.847 1.9

Expression

  Differential Expression (25)

Disease log2 FC p
Rheumatoid Arthritis 1.100 0.027
Multiple myeloma 1.103 0.018
ependymoma -2.000 0.000
psoriasis -1.200 0.004
osteosarcoma -1.212 0.031
glioblastoma -2.400 0.000
atypical teratoid / rhabdoid tumor -2.700 0.000
medulloblastoma -1.200 0.000
medulloblastoma, large-cell -1.900 0.000
primitive neuroectodermal tumor -1.100 0.041
tuberculosis 1.300 0.000
non-small cell lung cancer -1.878 0.000
intraductal papillary-mucinous neoplasm ... -1.300 0.007
lung cancer -3.900 0.044
colon cancer -1.500 0.002
sarcoidosis -1.200 0.016
pediatric high grade glioma -2.100 0.000
pilocytic astrocytoma -1.700 0.000
subependymal giant cell astrocytoma -1.909 0.006
invasive ductal carcinoma -1.500 0.005
spina bifida -1.200 0.043
Breast cancer -1.800 0.000
pterygium -1.100 0.003
ductal carcinoma in situ -1.100 0.000
ovarian cancer -2.500 0.000

Synonym

Accession P41567 Q9UNQ9 eIF1
Symbols A121
ISO1
SUI1
EIF-1
EIF1A

Gene

PDB

2IF1   4KZX   4KZY  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA Inparanoid
Pig OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
C. elegans OMA Inparanoid
S.cerevisiae OMA Inparanoid

 GO Component (2)

Gene RIF (6)

PMID Text
26018492 eIF1A is a novel component of the Ago2-centred RNA-induced silencing complexes (RISCs) and augments Ago2-dependent RNAi and miRNA biogenesis.
25738462 eEF4GI shares this activity and also interacts with eIF1.
25246524 eIF1, eIF1A, eIF3j, and the eIF2-GTP-Met-tRNAi ternary complex stably bind to the 43 S preinitiation complex
23293029 Coordinated movements of eukaryotic translation initiation factors eIF1, eIF1A, and eIF5 trigger phosphate release from eIF2 in response to start codon recognition by the ribosomal preinitiation complex
22813744 This study provides mechanistic insight into the role of eIF5-carboxyl terminal domain's dynamic interplay with eIF1 and eIF2beta.
20921384 show that the stringency of start codon selection (preferential utilization of optimal start sites) is increased to a surprising degree by overexpressing eIF1

AA Sequence

MSAIQNLHSFDPFADASKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACN      1 - 70
GTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF                                71 - 113
//

Text Mined References (23)

PMID Year Title
26018492 2015 eIF1A augments Ago2-mediated Dicer-independent miRNA biogenesis and RNA interference.
25738462 2015 Translational tolerance of mitochondrial genes to metabolic energy stress involves TISU and eIF1-eIF4GI cooperation in start codon selection.
25246524 2014 Human eukaryotic initiation factor 2 (eIF2)-GTP-Met-tRNAi ternary complex and eIF3 stabilize the 43 S preinitiation complex.
23293029 2013 Coordinated movements of eukaryotic translation initiation factors eIF1, eIF1A, and eIF5 trigger phosphate release from eIF2 in response to start codon recognition by the ribosomal preinitiation complex.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22813744 2012 The C-terminal domain of eukaryotic initiation factor 5 promotes start codon recognition by its dynamic interplay with eIF1 and eIF2?.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22156057 2012 Stringency of start codon selection modulates autoregulation of translation initiation factor eIF5.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20921384 2010 Initiation context modulates autoregulation of eukaryotic translation initiation factor 1 (eIF1).
More...