Property Summary

NCBI Gene PubMed Count 19
Grant Count 19
R01 Count 14
Funding $1,249,244.83
PubMed Score 111.26
PubTator Score 112.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
Rheumatoid Arthritis 1.100 0.027
Multiple myeloma 1.103 0.018
ependymoma -2.000 0.000
psoriasis -1.200 0.004
osteosarcoma -1.212 0.031
glioblastoma -2.400 0.000
atypical teratoid / rhabdoid tumor -2.700 0.000
medulloblastoma -1.200 0.000
medulloblastoma, large-cell -1.900 0.000
primitive neuroectodermal tumor -1.100 0.041
tuberculosis 1.300 0.000
non-small cell lung cancer -1.878 0.000
intraductal papillary-mucinous neoplasm ... -1.300 0.007
lung cancer -3.900 0.044
colon cancer -1.500 0.002
sarcoidosis -1.200 0.016
pediatric high grade glioma -2.100 0.000
pilocytic astrocytoma -1.700 0.000
subependymal giant cell astrocytoma -1.909 0.006
invasive ductal carcinoma -1.500 0.005
spina bifida -1.200 0.043
Breast cancer -1.800 0.000
pterygium -1.100 0.003
ductal carcinoma in situ -1.100 0.000
ovarian cancer -2.500 0.000

 GO Component (2)

Gene RIF (6)

PMID Text
26018492 eIF1A is a novel component of the Ago2-centred RNA-induced silencing complexes (RISCs) and augments Ago2-dependent RNAi and miRNA biogenesis.
25738462 eEF4GI shares this activity and also interacts with eIF1.
25246524 eIF1, eIF1A, eIF3j, and the eIF2-GTP-Met-tRNAi ternary complex stably bind to the 43 S preinitiation complex
23293029 Coordinated movements of eukaryotic translation initiation factors eIF1, eIF1A, and eIF5 trigger phosphate release from eIF2 in response to start codon recognition by the ribosomal preinitiation complex
22813744 This study provides mechanistic insight into the role of eIF5-carboxyl terminal domain's dynamic interplay with eIF1 and eIF2beta.
20921384 show that the stringency of start codon selection (preferential utilization of optimal start sites) is increased to a surprising degree by overexpressing eIF1

AA Sequence

MSAIQNLHSFDPFADASKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACN      1 - 70
GTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF                                71 - 113
//

Publication (23)

PMID Year Title
26018492 2015 eIF1A augments Ago2-mediated Dicer-independent miRNA biogenesis and RNA interference.
25738462 2015 Translational tolerance of mitochondrial genes to metabolic energy stress involves TISU and eIF1-eIF4GI cooperation in start codon selection.
25246524 2014 Human eukaryotic initiation factor 2 (eIF2)-GTP-Met-tRNAi ternary complex and eIF3 stabilize the 43 S preinitiation complex.
23293029 2013 Coordinated movements of eukaryotic translation initiation factors eIF1, eIF1A, and eIF5 trigger phosphate release from eIF2 in response to start codon recognition by the ribosomal preinitiation complex.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22813744 2012 The C-terminal domain of eukaryotic initiation factor 5 promotes start codon recognition by its dynamic interplay with eIF1 and eIF2?.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22156057 2012 Stringency of start codon selection modulates autoregulation of translation initiation factor eIF5.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20921384 2010 Initiation context modulates autoregulation of eukaryotic translation initiation factor 1 (eIF1).
More...