Property Summary

Ligand Count 17
NCBI Gene PubMed Count 166
PubMed Score 97.75
PubTator Score 217.80

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (13)

Disease log2 FC p
active Crohn's disease -1.144 2.9e-03
active ulcerative colitis -1.330 3.7e-03
adult high grade glioma -1.300 4.2e-04
Breast cancer 1.400 1.8e-14
colon cancer 1.300 5.0e-02
intraductal papillary-mucinous neoplasm ... 1.200 1.5e-03
malignant mesothelioma 1.500 1.1e-05
medulloblastoma, large-cell -1.100 6.1e-04
osteosarcoma -3.652 2.1e-10
ovarian cancer 1.400 7.9e-07
psoriasis 1.600 5.0e-04
sonic hedgehog group medulloblastoma 1.100 3.8e-04
tuberculosis 1.300 7.8e-07

 GWAS Trait (1)

Gene RIF (159)

AA Sequence

MVPSSPAVEKQVPVEPGPDPELRSWRHLVCYLCFYGFMAQIRPGESFITPYLLGPDKNFTREQVTNEITP      1 - 70
VLSYSYLAVLVPVFLLTDYLRYTPVLLLQGLSFVSVWLLLLLGHSVAHMQLMELFYSVTMAARIAYSSYI     71 - 140
FSLVRPARYQRVAGYSRAAVLLGVFTSSVLGQLLVTVGRVSFSTLNYISLAFLTFSVVLALFLKRPKRSL    141 - 210
FFNRDDRGRCETSASELERMNPGPGGKLGHALRVACGDSVLARMLRELGDSLRRPQLRLWSLWWVFNSAG    211 - 280
YYLVVYYVHILWNEVDPTTNSARVYNGAADAASTLLGAITSFAAGFVKIRWARWSKLLIAGVTATQAGLV    281 - 350
FLLAHTRHPSSIWLCYAAFVLFRGSYQFLVPIATFQIASSLSKELCALVFGVNTFFATIVKTIITFIVSD    351 - 420
VRGLGLPVRKQFQLYSVYFLILSIIYFLGAMLDGLRHCQRGHHPRQPPAQGLRSAAEEKAAQALSVQDKG    421 - 490
LGGLQPAQSPPLSPEDSLGAVGPASLEQRQSDPYLAQAPAPQAAEFLSPVTTPSPCTLCSAQASGPEAAD    491 - 560
ETCPQLAVHPPGVSKLGLQCLPSDGVQNVNQ                                           561 - 591
//

Text Mined References (173)

PMID Year Title