Property Summary

NCBI Gene PubMed Count 162
Grant Count 14
R01 Count 10
Funding $996,734.58
PubMed Score 92.50
PubTator Score 217.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
malignant mesothelioma 1.600 0.000
psoriasis 1.600 0.000
osteosarcoma -3.652 0.000
medulloblastoma, large-cell -1.100 0.001
tuberculosis 1.300 0.000
intraductal papillary-mucinous neoplasm ... 1.200 0.001
colon cancer 2.500 0.000
active Crohn's disease -1.144 0.003
active ulcerative colitis -1.330 0.004
adult high grade glioma -1.300 0.000
sonic hedgehog group medulloblastoma 1.400 0.000
Breast cancer 1.400 0.000
ovarian cancer 1.400 0.000

Gene RIF (154)

PMID Text
26193446 We conclude that SLC46A1/PCFT and SLC19A1/RFC-1 are associated with DFS of patients with colorectal cancer and hypothesize that poor response to 5-fluorouracil plus leucovorin therapy in some patients may be linked to low expression of these genes.
25860940 SLC19A1 expression was associated with increased risk of relapse or death, and SLC19A1 expression retained prognostic significance independent of age, disease stage and MYCN amplification.
25659099 the RFC-1 -43C>T, 80A>G, and 696T>C polymorphisms may be risk factors for ischemic stroke.
25124723 SLC19A1 genotype may help to identify patients with increased risk of methotrexate-related toxicity.
25078587 The reduced RFC mRNA expression in paclitaxel-resistant osteosarcoma cells may be related to the decrease in intracellular methotrexate concentration.
25074866 Results suggest that genetic polymorphisms in MDR1 and RCF1 the toxicity but not the response of methotrexate treatment.
24995314 Present results do not support a role for the RFC-1 c.80G>A polymorphism as independent risk factor for sporadic AD in Italian Caucasians
24927955 SLC19A1 rs1051296 G>T, a miRNA binding site polymorphism, was associated with increased plasma methotrexate concentrations in Chinese children with acute lymphoblastic leukemia.
24917213 SLC19A1 rs1051266 GG/GA genotype is associated with first trimester fever.
24782176 RFC1 80G>A is a genetic determinant of methotrexate efficacy in rheumatoid arthritis.
More...

AA Sequence

MVPSSPAVEKQVPVEPGPDPELRSWRHLVCYLCFYGFMAQIRPGESFITPYLLGPDKNFTREQVTNEITP      1 - 70
VLSYSYLAVLVPVFLLTDYLRYTPVLLLQGLSFVSVWLLLLLGHSVAHMQLMELFYSVTMAARIAYSSYI     71 - 140
FSLVRPARYQRVAGYSRAAVLLGVFTSSVLGQLLVTVGRVSFSTLNYISLAFLTFSVVLALFLKRPKRSL    141 - 210
FFNRDDRGRCETSASELERMNPGPGGKLGHALRVACGDSVLARMLRELGDSLRRPQLRLWSLWWVFNSAG    211 - 280
YYLVVYYVHILWNEVDPTTNSARVYNGAADAASTLLGAITSFAAGFVKIRWARWSKLLIAGVTATQAGLV    281 - 350
FLLAHTRHPSSIWLCYAAFVLFRGSYQFLVPIATFQIASSLSKELCALVFGVNTFFATIVKTIITFIVSD    351 - 420
VRGLGLPVRKQFQLYSVYFLILSIIYFLGAMLDGLRHCQRGHHPRQPPAQGLRSAAEEKAAQALSVQDKG    421 - 490
LGGLQPAQSPPLSPEDSLGAVGPASLEQRQSDPYLAQAPAPQAAEFLSPVTTPSPCTLCSAQASGPEAAD    491 - 560
ETCPQLAVHPPGVSKLGLQCLPSDGVQNVNQ                                           561 - 591
//

Text Mined References (169)

PMID Year Title
26193446 2015 Expression of Folate Pathway Genes in Stage III Colorectal Cancer Correlates with Recurrence Status Following Adjuvant Bolus 5-FU-Based Chemotherapy.
25860940 2015 MYCN amplification confers enhanced folate dependence and methotrexate sensitivity in neuroblastoma.
25659099 2015 Association of reduced folate carrier-1 (RFC-1) polymorphisms with ischemic stroke and silent brain infarction.
25124723 2014 SLC19A1, SLC46A1 and SLCO1B1 polymorphisms as predictors of methotrexate-related toxicity in Portuguese rheumatoid arthritis patients.
25078587 2014 Relationship between RFC gene expression and intracellular drug concentration in methotrexate-resistant osteosarcoma cells.
25074866 2014 Association of MDR1 C3435T and RFC1 G80A polymorphisms with methotrexate toxicity and response in Jordanian rheumatoid arthritis patients.
24995314 2014 A pilot study evaluating the contribution of SLC19A1 (RFC-1) 80G>a polymorphism to Alzheimer's disease in Italian Caucasians.
24927955 2014 Effects of a microRNA binding site polymorphism in SLC19A1 on methotrexate concentrations in Chinese children with acute lymphoblastic leukemia.
24917213 2015 Interaction between the SLC19A1 gene and maternal first trimester fever on offspring neural tube defects.
24782176 2014 RFC1 80G>A is a genetic determinant of methotrexate efficacy in rheumatoid arthritis: a human genome epidemiologic review and meta-analysis of observational studies.
More...