Property Summary

NCBI Gene PubMed Count 94
Grant Count 81
R01 Count 30
Funding $8,001,268.84
PubMed Score 137.88
PubTator Score 102.80

Knowledge Summary

Patent (54,861)

Expression

  Differential Expression (19)

Disease log2 FC p
Rheumatoid Arthritis 1.400 0.039
interstitial lung disease -1.600 0.017
malignant mesothelioma -1.800 0.000
psoriasis 1.500 0.001
adrenocortical carcinoma -1.261 0.005
tuberculosis -2.000 0.000
non-small cell lung cancer -1.604 0.000
lung cancer -3.000 0.000
active Crohn's disease 1.344 0.031
ulcerative colitis 2.400 0.000
interstitial cystitis 1.400 0.000
cystic fibrosis and chronic rhinosinusit... -1.531 0.026
pilocytic astrocytoma 1.100 0.001
posterior fossa group A ependymoma 1.400 0.000
lung carcinoma -2.100 0.000
gastric carcinoma 1.700 0.014
acute myeloid leukemia 1.500 0.044
ovarian cancer -2.900 0.000
chronic rhinosinusitis -2.045 0.009

Synonym

Accession P41279 A8K2Q5 D3DRX1 Q14275 Q5T855 Q9HC81
Symbols COT
EST
ESTF
TPL2
AURA2
MEKK8
Tpl-2
c-COT

Gene

PDB

4Y83   4Y85   5IU2  

Gene RIF (64)

PMID Text
25918157 structurally versatile active site significantly impacts the design of potent, low molecular weight COT kinase inhibitors
25815776 the results of the present study demonstrated that the miR-509-3p RCC suppressor was a significant regulator of the MAP3K8 oncogene, suggesting that it may have a potential therapeutic role in the treatment of renal cell carcinoma
25723737 Studies indicate that Tpl2, a MAP3K, participates in a broad range of cancer-related signaling pathways and induces tumorigenesis and progression of many cancers.
25674762 Aberrant expression of A-, B-, and C-RAF, and COT is frequent in PTC; increased expression of COT is correlated with recurrence of PTC.
25531326 findings provide a novel perspective on the role of the IL-33/ST2/COT signaling pathway in supporting cancer-associated inflammation in the tumor microenvironment
25316791 Following epithelial injury, intestinal myofibroblasts sense innate or inflammatory signals and activate, via Tpl2, the cyclooxygenase-2 (Cox-2)-prostaglandin E2 (PGE2) pathway, which are essential for the epithelial homeostatic response.
25274482 Tpl2 overexpression and downregulation showed significant stimulatory and inhibitory effects on tumorigenic and metastatic potential of ADI PC cells.
24998852 TPL2 mediates the phosphorylation of a fraction of nucleophosmin at threonine 199, an event required for its proteasomal degradation and maintenance of steady-state nucleophosmin levels.
24819603 MAP3K8 and miR-17-5p expression were inversely correlated with treatment response
24723682 Coregulation of TLR2 and TLR6 expression correlating with local processing of versican, a proteoglycan TLR2/6 agonist linked to carcinoma progression.
More...

AA Sequence

MEYMSTGSDNKEEIDLLIKHLNVSDVIDIMENLYASEEPAVYEPSLMTMCQDSNQNDERSKSLLLSGQEV      1 - 70
PWLSSVRYGTVEDLLAFANHISNTAKHFYGQRPQESGILLNMVITPQNGRYQIDSDVLLIPWKLTYRNIG     71 - 140
SDFIPRGAFGKVYLAQDIKTKKRMACKLIPVDQFKPSDVEIQACFRHENIAELYGAVLWGETVHLFMEAG    141 - 210
EGGSVLEKLESCGPMREFEIIWVTKHVLKGLDFLHSKKVIHHDIKPSNIVFMSTKAVLVDFGLSVQMTED    211 - 280
VYFPKDLRGTEIYMSPEVILCRGHSTKADIYSLGATLIHMQTGTPPWVKRYPRSAYPSYLYIIHKQAPPL    281 - 350
EDIADDCSPGMRELIEASLERNPNHRPRAADLLKHEALNPPREDQPRCQSLDSALLERKRLLSRKELELP    351 - 420
ENIADSSCTGSTEESEMLKRQRSLYIDLGALAGYFNLVRGPPTLEYG                           421 - 467
//

Text Mined References (104)

PMID Year Title
25918157 2015 The Crystal Structure of Cancer Osaka Thyroid Kinase Reveals an Unexpected Kinase Domain Fold.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25815776 2015 MicroRNA-509-3p inhibits cancer cell proliferation and migration by targeting the mitogen-activated protein kinase kinase kinase 8 oncogene in renal cell carcinoma.
25723737 2015 Tumor progression locus 2 (Tpl2) kinase as a novel therapeutic target for cancer: double-sided effects of Tpl2 on cancer.
25674762 2015 Aberrant expression of COT is related to recurrence of papillary thyroid cancer.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25531326 2015 Interleukin-33/ST2 axis promotes epithelial cell transformation and breast tumorigenesis via upregulation of COT activity.
25316791 2014 Intestinal myofibroblast-specific Tpl2-Cox-2-PGE2 pathway links innate sensing to epithelial homeostasis.
25274482 2015 Tpl2 induces castration resistant prostate cancer progression and metastasis.
24998852 2015 Physical and functional interaction of the TPL2 kinase with nucleophosmin.
More...