Property Summary

Ligand Count 43
NCBI Gene PubMed Count 101
PubMed Score 154.28
PubTator Score 102.80

Knowledge Summary

Patent (54,861)

Expression

  Differential Expression (19)

Disease log2 FC p
lung cancer -3.000 9.8e-06
active Crohn's disease 1.344 3.1e-02
active ulcerative colitis 1.011 3.4e-02
acute myeloid leukemia 1.500 4.4e-02
adrenocortical carcinoma -1.261 5.5e-03
Astrocytoma, Pilocytic 1.100 7.2e-04
chronic rhinosinusitis -2.045 8.7e-03
cystic fibrosis 1.500 1.3e-03
gastric carcinoma 1.700 1.4e-02
interstitial cystitis 1.300 7.9e-04
interstitial lung disease -1.600 1.7e-02
lung carcinoma -2.100 1.1e-25
malignant mesothelioma -1.800 5.2e-07
non-small cell lung cancer -1.604 1.2e-13
ovarian cancer -2.900 5.1e-07
posterior fossa group A ependymoma 1.400 5.1e-05
psoriasis 1.500 9.3e-04
Rheumatoid arthritis 1.400 3.9e-02
tuberculosis -2.000 2.5e-06

 OMIM Phenotype (1)

Protein-protein Interaction (2)

Gene RIF (71)

AA Sequence

MEYMSTGSDNKEEIDLLIKHLNVSDVIDIMENLYASEEPAVYEPSLMTMCQDSNQNDERSKSLLLSGQEV      1 - 70
PWLSSVRYGTVEDLLAFANHISNTAKHFYGQRPQESGILLNMVITPQNGRYQIDSDVLLIPWKLTYRNIG     71 - 140
SDFIPRGAFGKVYLAQDIKTKKRMACKLIPVDQFKPSDVEIQACFRHENIAELYGAVLWGETVHLFMEAG    141 - 210
EGGSVLEKLESCGPMREFEIIWVTKHVLKGLDFLHSKKVIHHDIKPSNIVFMSTKAVLVDFGLSVQMTED    211 - 280
VYFPKDLRGTEIYMSPEVILCRGHSTKADIYSLGATLIHMQTGTPPWVKRYPRSAYPSYLYIIHKQAPPL    281 - 350
EDIADDCSPGMRELIEASLERNPNHRPRAADLLKHEALNPPREDQPRCQSLDSALLERKRLLSRKELELP    351 - 420
ENIADSSCTGSTEESEMLKRQRSLYIDLGALAGYFNLVRGPPTLEYG                           421 - 467
//

Text Mined References (111)

PMID Year Title