Property Summary

NCBI Gene PubMed Count 66
PubMed Score 185.85
PubTator Score 101.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Dermatitis, Contact 71 0.0 0.0
Stomach Neoplasms 300 0.0 0.0
Disease Target Count
Contact Dermatitis 81
Disease Target Count Z-score Confidence
Cancer 2499 4.204 2.1
Influenza 142 3.33 1.7

Expression

  Differential Expression (7)

Disease log2 FC p
active ulcerative colitis 2.467 4.1e-02
astrocytic glioma -1.200 3.9e-02
ependymoma -1.400 4.3e-02
lung cancer -1.400 7.7e-04
malignant mesothelioma 3.600 3.2e-09
medulloblastoma, large-cell -1.100 1.4e-04
oligodendroglioma -1.200 4.6e-02

Gene RIF (55)

AA Sequence

MEYASDASLDPEAPWPPAPRARACRVLPWALVAGLLLLLLLAAACAVFLACPWAVSGARASPGSAASPRL      1 - 70
REGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGV     71 - 140
YYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQ    141 - 210
RLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE                              211 - 254
//

Text Mined References (66)

PMID Year Title