Property Summary

NCBI Gene PubMed Count 63
Grant Count 88
R01 Count 51
Funding $10,197,373.72
PubMed Score 177.62
PubTator Score 101.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma 3.600 0.000
astrocytic glioma -1.200 0.039
ependymoma -1.400 0.043
oligodendroglioma -1.200 0.046
medulloblastoma, large-cell -1.100 0.000
lung cancer -1.900 0.000
active ulcerative colitis 2.467 0.041

Synonym

Accession P41273 Q2M3S2
Symbols CD137L
TNLG5A
4-1BB-L

Gene

PDB

2X29  

Gene RIF (52)

PMID Text
26872462 blocking of both OX-40L and 4-1BBL reversed radiation-enhanced T-cell killing of human tumor targets as well as T-cell survival and activation.
26125931 In vitro immunotherapy is described for anti-prostate cancer effects of cytotoxic T lymphocytes induction by recombinant adenovirus mediated PSMA/4-1BBL dendritic cells.
26116899 HIV-1 Vpr upregulates the gene expression of TNFSF9 in human monocyte-derived dendritic cells
25872647 vaccination with recombinant attenuated Salmonella harboring the CEACAM6 and 4-1BBL gene efficiently increased the number of CD3+CD8+ TIL and NK cells, decreased the number of FOXP3 cells and inhibited the development of DMH-induced colorectal cancer
25631633 CD137L is overexpressed in non-small cell lung cancer specimens and positive expression of CD137L was associated with better overall survival.
24899613 Elevated plasma levels and monocyte-associated expression of CD137 ligand in patients with acute atherothrombotic stroke
24639347 monocytes interact with iNKT cells to increase expression of 4-1BBL and 4-1BB, and in conjunction with this pathway, maintain their numbers at baseline.
24198185 Hence, the targeted combination of IL-15 and 4-BBL in the form of a trifunctional antibody-fusion protein is a promising new approach for cancer immunotherapy.
24084649 TIRAP and IRAK2 are critical for the sustained inflammatory response that is mediated by late-phase signaling by the TLR-4-1BBL complex.
23620528 Data show that TNFR1 associates with CD137L and is required for CD137L reverse signaling.
More...

AA Sequence

MEYASDASLDPEAPWPPAPRARACRVLPWALVAGLLLLLLLAAACAVFLACPWAVSGARASPGSAASPRL      1 - 70
REGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGV     71 - 140
YYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQ    141 - 210
RLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE                              211 - 254
//

Text Mined References (63)

PMID Year Title
26872462 2016 Effector function of CTLs is increased by irradiated colorectal tumor cells that modulate OX-40L and 4-1BBL and is reversed following dual blockade.
26646413 2016 Comparative genomic analysis of eutherian tumor necrosis factor ligand genes.
26125931 2015 Anti-prostate cancer effects of CTL cell induction in vitro by recombinant adenovirus mediated PSMA/4-1BBL dendritic cells: an immunotherapy study.
25872647 2015 Recombinant Salmonella-based CEACAM6 and 4-1BBL vaccine enhances T-cell immunity and inhibits the development of colorectal cancer in rats: In vivo effects of vaccine containing 4-1BBL and CEACAM6.
25631633 2015 CD137 ligand-mediated reverse signaling inhibits proliferation and induces apoptosis in non-small cell lung cancer.
24899613 2014 Elevated plasma levels and monocyte-associated expression of CD137 ligand in patients with acute atherothrombotic stroke.
24639347 2014 Involvement of the 4-1BB/4-1BBL pathway in control of monocyte numbers by invariant NKT cells.
24198185 2014 Combining antibody-directed presentation of IL-15 and 4-1BBL in a trifunctional fusion protein for cancer immunotherapy.
24084649 2013 The TNF family member 4-1BBL sustains inflammation by interacting with TLR signaling components during late-phase activation.
23620528 2013 Tumor necrosis factor receptor 1 associates with CD137 ligand and mediates its reverse signaling.
More...