Property Summary

NCBI Gene PubMed Count 63
PubMed Score 177.62
PubTator Score 101.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
malignant mesothelioma 3163 3.22885351750802E-9
lung cancer 4473 6.70219863909324E-5
medulloblastoma, large-cell 6234 1.44669660104412E-4
astrocytic glioma 2241 0.0391610966408409
active ulcerative colitis 477 0.0414311585506631
ependymoma 2514 0.043158072819039
oligodendroglioma 2849 0.0461210720319513
Disease Target Count Z-score Confidence
Cancer 2346 4.145 2.1
Influenza 142 3.277 1.6

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma 3.600 0.000
astrocytic glioma -1.200 0.039
ependymoma -1.400 0.043
oligodendroglioma -1.200 0.046
medulloblastoma, large-cell -1.100 0.000
lung cancer -1.900 0.000
active ulcerative colitis 2.467 0.041

Synonym

Accession P41273 Q2M3S2
Symbols CD137L
TNLG5A
4-1BB-L

Gene

PDB

2X29  

  Ortholog (9)

Species Source
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG
Platypus OMA EggNOG

Gene RIF (52)

PMID Text
26872462 blocking of both OX-40L and 4-1BBL reversed radiation-enhanced T-cell killing of human tumor targets as well as T-cell survival and activation.
26125931 In vitro immunotherapy is described for anti-prostate cancer effects of cytotoxic T lymphocytes induction by recombinant adenovirus mediated PSMA/4-1BBL dendritic cells.
26116899 HIV-1 Vpr upregulates the gene expression of TNFSF9 in human monocyte-derived dendritic cells
25872647 vaccination with recombinant attenuated Salmonella harboring the CEACAM6 and 4-1BBL gene efficiently increased the number of CD3+CD8+ TIL and NK cells, decreased the number of FOXP3 cells and inhibited the development of DMH-induced colorectal cancer
25631633 CD137L is overexpressed in non-small cell lung cancer specimens and positive expression of CD137L was associated with better overall survival.
24899613 Elevated plasma levels and monocyte-associated expression of CD137 ligand in patients with acute atherothrombotic stroke
24639347 monocytes interact with iNKT cells to increase expression of 4-1BBL and 4-1BB, and in conjunction with this pathway, maintain their numbers at baseline.
24198185 Hence, the targeted combination of IL-15 and 4-BBL in the form of a trifunctional antibody-fusion protein is a promising new approach for cancer immunotherapy.
24084649 TIRAP and IRAK2 are critical for the sustained inflammatory response that is mediated by late-phase signaling by the TLR-4-1BBL complex.
23620528 Data show that TNFR1 associates with CD137L and is required for CD137L reverse signaling.
More...

AA Sequence

MEYASDASLDPEAPWPPAPRARACRVLPWALVAGLLLLLLLAAACAVFLACPWAVSGARASPGSAASPRL      1 - 70
REGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGV     71 - 140
YYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQ    141 - 210
RLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE                              211 - 254
//

Text Mined References (63)

PMID Year Title
26872462 2016 Effector function of CTLs is increased by irradiated colorectal tumor cells that modulate OX-40L and 4-1BBL and is reversed following dual blockade.
26646413 2016 Comparative genomic analysis of eutherian tumor necrosis factor ligand genes.
26125931 2015 Anti-prostate cancer effects of CTL cell induction in vitro by recombinant adenovirus mediated PSMA/4-1BBL dendritic cells: an immunotherapy study.
25872647 2015 Recombinant Salmonella-based CEACAM6 and 4-1BBL vaccine enhances T-cell immunity and inhibits the development of colorectal cancer in rats: In vivo effects of vaccine containing 4-1BBL and CEACAM6.
25631633 2015 CD137 ligand-mediated reverse signaling inhibits proliferation and induces apoptosis in non-small cell lung cancer.
24899613 2014 Elevated plasma levels and monocyte-associated expression of CD137 ligand in patients with acute atherothrombotic stroke.
24639347 2014 Involvement of the 4-1BB/4-1BBL pathway in control of monocyte numbers by invariant NKT cells.
24198185 2014 Combining antibody-directed presentation of IL-15 and 4-1BBL in a trifunctional fusion protein for cancer immunotherapy.
24084649 2013 The TNF family member 4-1BBL sustains inflammation by interacting with TLR signaling components during late-phase activation.
23620528 2013 Tumor necrosis factor receptor 1 associates with CD137 ligand and mediates its reverse signaling.
More...