Property Summary

NCBI Gene PubMed Count 26
PubMed Score 362.87
PubTator Score 3042.01

Knowledge Summary

Patent

No data available

Expression

Gene RIF (8)

AA Sequence

MMLRVLVGAVLPAMLLAAPPPINKLALFPDKSAWCEAKNITQIVGHSGCEAKSIQNRACLGQCFSYSVPN      1 - 70
TFPQSTESLVHCDSCMPAQSMWEIVTLECPGHEEVPRVDKLVEKILHCSCQACGKEPSHEGLSVYVQGED     71 - 140
GPGSQPGTHPHPHPHPHPGGQTPEPEDPPGAPHTEEEGAED                                 141 - 181
//

Text Mined References (28)

PMID Year Title