Property Summary

NCBI Gene PubMed Count 49
PubMed Score 412.84
PubTator Score 94.69

Knowledge Summary


No data available


  Differential Expression (5)

Disease log2 FC p
juvenile dermatomyositis 1.070 1.6e-08
lung cancer 1.100 6.2e-04
Multiple myeloma 1.690 5.4e-04
non-small cell lung cancer 1.228 6.2e-27
ovarian cancer 2.800 4.0e-08

Gene RIF (30)

AA Sequence

ELPSIVQDLANGNITWADVEARYPLFEGQETGKKETIEE                                   701 - 739

Text Mined References (59)

PMID Year Title