Property Summary

NCBI Gene PubMed Count 15
PubMed Score 6.90
PubTator Score 44.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
acute myeloid leukemia -1.500 1.2e-02
astrocytic glioma -1.200 1.8e-02
atypical teratoid/rhabdoid tumor -1.200 5.4e-03
cutaneous lupus erythematosus -1.100 4.6e-03
glioblastoma -1.300 2.5e-02
group 3 medulloblastoma -1.300 1.4e-02
lung cancer -1.900 1.1e-03
malignant mesothelioma -1.300 6.4e-06
medulloblastoma, large-cell -1.400 4.4e-03
non primary Sjogren syndrome sicca 1.500 1.4e-02
oligodendroglioma -1.100 1.1e-02
ovarian cancer -2.200 3.9e-10
pediatric high grade glioma -1.400 9.8e-04
primitive neuroectodermal tumor -1.500 3.3e-02

Gene RIF (7)

AA Sequence

MKHINLSFAACGFLGIYHLGAASALCRHGKKLVKDVKAFAGASAGSLVASVLLTAPEKIEECNQFTYKFA      1 - 70
EEIRRQSFGAVTPGYDFMARLRSGMESILPPSAHELAQNRLHVSITNAKTRENHLVSTFSSREDLIKVLL     71 - 140
ASSFVPIYAGLKLVEYKGQKWVDGGLTNALPILPVGRTVTISPFSGRLDISPQDKGQLDLYVNIAKQDIM    141 - 210
LSLANLVRLNQALFPPSKRKMESLYQCGFDDTVKFLLKENWFE                               211 - 253
//

Text Mined References (17)

PMID Year Title