Property Summary

NCBI Gene PubMed Count 14
PubMed Score 5.82
PubTator Score 44.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 3.88359763575374E-10
sonic hedgehog group medulloblastoma 1482 3.11502681169035E-6
malignant mesothelioma 3163 6.35079038874036E-6
pediatric high grade glioma 2712 9.81574233182715E-4
lung cancer 4473 0.00108519034600308
medulloblastoma, large-cell 6234 0.00435761328180169
cutaneous lupus erythematosus 1056 0.00464020706666938
atypical teratoid/rhabdoid tumor 1095 0.00537296459739173
astrocytic glioma 2241 0.00948843681939263
acute myeloid leukemia 785 0.0116251166278542
non primary Sjogren syndrome sicca 840 0.0136284169815466
glioblastoma 5572 0.0254259057398214
oligodendroglioma 2849 0.0318862354586758
primitive neuroectodermal tumor 3031 0.0328590352887167
Disease Target Count Z-score Confidence
Hypogonadism 70 3.288 1.6
Edwards syndrome 15 3.114 1.6
Kennedy's disease 13 3.023 1.5

Expression

  Differential Expression (14)

Synonym

Accession P41247 A8K1H3 B4E362 Q8WW83
Symbols GS2
DXS1283E
iPLA2eta

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid
C. elegans OMA EggNOG

Gene RIF (6)

PMID Text
19390624 No association between genetic variants in PNPLA4 genes and childhood and adolescent obesity
19390624 Observational study of gene-disease association. (HuGE Navigator)
19181555 GS2 promotes RE accumulation and may do so either as a catalyst or as a regulatory protein that enhances retinylesters formation catalyzed by other acyl transferases.
16741517 we report the identity of an inhibitor, TIP47, which prevents retinylester hydrolysis catalyzed by GS2 lipase and hormone-sensitive lipase
15955102 The GS2 gene (PNPLA4) encodes a keratinocyte retinyl ester hydrolase. The protein also catalyzes fatty acyl CoA-dependent and -independent retinol esterification, using triolein as substrate and generates diacylglyceride and free fatty acid.
15364929 iPLA2epsilon (adiponutrin), iPLA2zeta (TTS-2.2), and iPLA2eta (GS2) are three novel TAG lipases/acylglycerol transacylases that likely participate in TAG hydrolysis and the acyl-CoA independent transacylation of acylglycerols

AA Sequence

MKHINLSFAACGFLGIYHLGAASALCRHGKKLVKDVKAFAGASAGSLVASVLLTAPEKIEECNQFTYKFA      1 - 70
EEIRRQSFGAVTPGYDFMARLRSGMESILPPSAHELAQNRLHVSITNAKTRENHLVSTFSSREDLIKVLL     71 - 140
ASSFVPIYAGLKLVEYKGQKWVDGGLTNALPILPVGRTVTISPFSGRLDISPQDKGQLDLYVNIAKQDIM    141 - 210
LSLANLVRLNQALFPPSKRKMESLYQCGFDDTVKFLLKENWFE                               211 - 253
//

Text Mined References (16)

PMID Year Title
26741492 2016 A Comprehensive Genomic Analysis Reveals the Genetic Landscape of Mitochondrial Respiratory Chain Complex Deficiencies.
19390624 2009 Genetic variance in the adiponutrin gene family and childhood obesity.
19181555 2009 GS2 as a retinol transacylase and as a catalytic dyad independent regulator of retinylester accretion.
19029121 2009 Mammalian patatin domain containing proteins: a family with diverse lipolytic activities involved in multiple biological functions.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17603008 2007 A comparative study of human GS2, its paralogues, and its rat orthologue.
16799181 2006 Characterization of the human patatin-like phospholipase family.
16741517 2006 Molecular screening for GS2 lipase regulators: inhibition of keratinocyte retinylester hydrolysis by TIP47.
16341674 2005 Transcriptome analysis of human gastric cancer.
15955102 2005 Identification of a novel keratinocyte retinyl ester hydrolase as a transacylase and lipase.
More...