Property Summary

Ligand Count 5
NCBI Gene PubMed Count 194
PubMed Score 271.31
PubTator Score 354.24

Knowledge Summary

Patent (17,158)


  Differential Expression (7)

Disease log2 FC p
group 4 medulloblastoma 1.100 5.9e-06
intraductal papillary-mucinous carcinoma... 1.100 3.9e-04
intraductal papillary-mucinous neoplasm ... 1.400 1.9e-03
osteosarcoma -1.906 3.2e-05
ovarian cancer 1.800 1.6e-06
psoriasis -1.200 4.7e-03
tuberculosis 1.100 4.4e-07

Protein-protein Interaction (6)

Gene RIF (114)

AA Sequence

NCWHLDAAMRPSFLQLREQLEHIKTHELHL                                            421 - 450

Text Mined References (204)

PMID Year Title