Property Summary

NCBI Gene PubMed Count 188
Grant Count 218
R01 Count 154
Funding $16,776,851.58
PubMed Score 262.16
PubTator Score 354.24

Knowledge Summary

Patent (17,158)

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis -1.200 0.005
osteosarcoma -1.906 0.000
tuberculosis 1.100 0.000
intraductal papillary-mucinous carcinoma... 1.100 0.000
intraductal papillary-mucinous neoplasm ... 1.400 0.002
group 4 medulloblastoma 1.100 0.000
ovarian cancer 1.800 0.000

Synonym

Accession P41240 Q2M3N2 Q6FGZ6
Symbols

Gene

CSK

PDB

1BYG   1CSK   3D7T   3D7U   3EAC   3EAZ  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (108)

PMID Text
26458874 Our results do not support association between PTPN22/CSK and Henoch-Schonlein purpura
26091350 Results identify CSK downregulation as a principal driver of SRC activation and castration resistance.
25897081 CSK is the kinase responsible for C-terminal phosphorylation of SRC, but not BRK.
25618516 Variant rs1378942 near CSK was nominally associated with systolic blood pressure in a Chinese population.
25469771 Data indicate that the potent c-Src inhibitors pyrazolo[3,4-d]pyrimidines showed in vivo activity in neuroblastoma xenograft model.
24996174 the activity of SIRT2 is regulated by c-Src through post-translational modifications.
24902122 Haemophilus ducreyi LspA1 protein inhibits phagocytosis by activation of host CSK.
24648518 Data indicate that the accumulation of the cleaved C-terminal small fragment of eukaryotic elongation factor 2 (eEF2) in the nucleus, and C-terminal Src kinase (Csk) could enhance the proteolytic cleavage of eEF2.
24300854 JAM-A recruits Csk to the integrin-c-Src complex, where Csk negatively regulates c-Src activation, thereby suppressing the initiation of outside-in signaling.
24180592 alpha6beta4 integrin and c-Src activation is important early signaling events to lead mTOR activation and cap-dependent translation of VEGF.
More...

AA Sequence

MSAIQAAWPSGTECIAKYNFHGTAEQDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGIIPANYVQKREG      1 - 70
VKAGTKLSLMPWFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCVSCDGKVEHYRIMYHASKLSI     71 - 140
DEEVYFENLMQLVEHYTSDADGLCTRLIKPKVMEGTVAAQDEFYRSGWALNMKELKLLQTIGKGEFGDVM    141 - 210
LGDYRGNKVAVKCIKNDATAQAFLAEASVMTQLRHSNLVQLLGVIVEEKGGLYIVTEYMAKGSLVDYLRS    211 - 280
RGRSVLGGDCLLKFSLDVCEAMEYLEGNNFVHRDLAARNVLVSEDNVAKVSDFGLTKEASSTQDTGKLPV    281 - 350
KWTAPEALREKKFSTKSDVWSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYEVMK    351 - 420
NCWHLDAAMRPSFLQLREQLEHIKTHELHL                                            421 - 450
//

Text Mined References (198)

PMID Year Title
26458874 2015 Role of PTPN22 and CSK gene polymorphisms as predictors of susceptibility and clinical heterogeneity in patients with Henoch-Schönlein purpura (IgA vasculitis).
26091350 2015 Downregulation of c-SRC kinase CSK promotes castration resistant prostate cancer and pinpoints a novel disease subclass.
25897081 2015 Protein-tyrosine Phosphatase and Kinase Specificity in Regulation of SRC and Breast Tumor Kinase.
25618516 2015 Variant Near FGF5 Has Stronger Effects on Blood Pressure in Chinese With a Higher Body Mass Index.
25469771 2015 Combining X-ray crystallography and molecular modeling toward the optimization of pyrazolo[3,4-d]pyrimidines as potent c-Src inhibitors active in vivo against neuroblastoma.
24996174 2014 Src regulates the activity of SIRT2.
24902122 2014 The Haemophilus ducreyi LspA1 protein inhibits phagocytosis by using a new mechanism involving activation of C-terminal Src kinase.
24658140 2014 The mammalian-membrane two-hybrid assay (MaMTH) for probing membrane-protein interactions in human cells.
24648518 2014 C-terminal Src kinase (Csk)-mediated phosphorylation of eukaryotic elongation factor 2 (eEF2) promotes proteolytic cleavage and nuclear translocation of eEF2.
24300854 2014 Junctional adhesion molecule-A suppresses platelet integrin ?IIb?3 signaling by recruiting Csk to the integrin-c-Src complex.
More...