Property Summary

NCBI Gene PubMed Count 188
PubMed Score 262.16
PubTator Score 354.24

Knowledge Summary

Patent (17,158)


  Differential Expression (7)

Disease log2 FC p
psoriasis -1.200 0.005
osteosarcoma -1.906 0.000
tuberculosis 1.100 0.000
intraductal papillary-mucinous carcinoma... 1.100 0.000
intraductal papillary-mucinous neoplasm ... 1.400 0.002
group 4 medulloblastoma 1.100 0.000
ovarian cancer 1.800 0.000


Accession P41240 Q2M3N2 Q6FGZ6




1BYG   1CSK   3D7T   3D7U   3EAC   3EAZ  

  Ortholog (10)

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (108)

26458874 Our results do not support association between PTPN22/CSK and Henoch-Schonlein purpura
26091350 Results identify CSK downregulation as a principal driver of SRC activation and castration resistance.
25897081 CSK is the kinase responsible for C-terminal phosphorylation of SRC, but not BRK.
25618516 Variant rs1378942 near CSK was nominally associated with systolic blood pressure in a Chinese population.
25469771 Data indicate that the potent c-Src inhibitors pyrazolo[3,4-d]pyrimidines showed in vivo activity in neuroblastoma xenograft model.
24996174 the activity of SIRT2 is regulated by c-Src through post-translational modifications.
24902122 Haemophilus ducreyi LspA1 protein inhibits phagocytosis by activation of host CSK.
24648518 Data indicate that the accumulation of the cleaved C-terminal small fragment of eukaryotic elongation factor 2 (eEF2) in the nucleus, and C-terminal Src kinase (Csk) could enhance the proteolytic cleavage of eEF2.
24300854 JAM-A recruits Csk to the integrin-c-Src complex, where Csk negatively regulates c-Src activation, thereby suppressing the initiation of outside-in signaling.
24180592 alpha6beta4 integrin and c-Src activation is important early signaling events to lead mTOR activation and cap-dependent translation of VEGF.

AA Sequence

NCWHLDAAMRPSFLQLREQLEHIKTHELHL                                            421 - 450

Text Mined References (198)

PMID Year Title
26458874 2015 Role of PTPN22 and CSK gene polymorphisms as predictors of susceptibility and clinical heterogeneity in patients with Henoch-Schönlein purpura (IgA vasculitis).
26091350 2015 Downregulation of c-SRC kinase CSK promotes castration resistant prostate cancer and pinpoints a novel disease subclass.
25897081 2015 Protein-tyrosine Phosphatase and Kinase Specificity in Regulation of SRC and Breast Tumor Kinase.
25618516 2015 Variant Near FGF5 Has Stronger Effects on Blood Pressure in Chinese With a Higher Body Mass Index.
25469771 2015 Combining X-ray crystallography and molecular modeling toward the optimization of pyrazolo[3,4-d]pyrimidines as potent c-Src inhibitors active in vivo against neuroblastoma.
24996174 2014 Src regulates the activity of SIRT2.
24902122 2014 The Haemophilus ducreyi LspA1 protein inhibits phagocytosis by using a new mechanism involving activation of C-terminal Src kinase.
24658140 2014 The mammalian-membrane two-hybrid assay (MaMTH) for probing membrane-protein interactions in human cells.
24648518 2014 C-terminal Src kinase (Csk)-mediated phosphorylation of eukaryotic elongation factor 2 (eEF2) promotes proteolytic cleavage and nuclear translocation of eEF2.
24300854 2014 Junctional adhesion molecule-A suppresses platelet integrin ?IIb?3 signaling by recruiting Csk to the integrin-c-Src complex.