Property Summary

NCBI Gene PubMed Count 39
Grant Count 61
R01 Count 31
Funding $5,133,210.49
PubMed Score 92.20
PubTator Score 67.95

Knowledge Summary

Patent

No data available

Synonym

Accession P41238 Q9UE64 Q9UM71
Symbols BEDP
HEPR
CDAR1
APOBEC-1

Gene

PANTHER Protein Class (2)

 GO Component (2)

Gene RIF (23)

PMID Text
26398702 AICDA/APOBEC family of cytidine deaminases is significant in innate immunity, as it restricts numerous viruses, including HBV, through hypermutationdependent and independent mechanisms. (Review)
25839328 An APOBEC-mediated mutational signature in 47% of 192 tumors suggests that APOBEC-catalyzed deamination provides a source of DNA damage in esophageal squamous cell carcinoma.
25100733 hnRNPQ6 is required for APOBEC1-enhanced IL8 production.
25085003 Results show that expression of APOBEC1 induces a mutator phenotype in 2 different cellular models.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20348446 The hypermutation activity of APOBEC-1 was decreased to background levels by a single point APOBEC-1 mutation of P29F or E181Q, while 50% of wild-type control editing at the normal site was retained.
20331378 Observational study of gene-disease association. (HuGE Navigator)
19965785 Identified two novel variants, rs1349411 (APOBEC1) and rs1424032, for serum apoB levels in Mexicans.
19932086 The data presented in this report suggested that similar regulatory mechanisms controlling the functional interaction of APOBEC-1 with ACF might be operational during enterocyte differentiation.
19913121 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MTSEKGPSTGDPTLRRRIEPWEFDVFYDPRELRKEACLLYEIKWGMSRKIWRSSGKNTTNHVEVNFIKKF      1 - 70
TSERDFHPSMSCSITWFLSWSPCWECSQAIREFLSRHPGVTLVIYVARLFWHMDQQNRQGLRDLVNSGVT     71 - 140
IQIMRASEYYHCWRNFVNYPPGDEAHWPQYPPLWMMLYALELHCIILSLPPCLKISRRWQNHLTFFRLHL    141 - 210
QNCHYQTIPPHILLATGLIHPSVAWR                                                211 - 236
//

Text Mined References (39)

PMID Year Title
26398702 2015 Associations between activation-induced cytidine deaminase/apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like cytidine deaminase expression, hepatitis B virus (HBV) replication and HBV-associated liver disease (Review).
25839328 2015 Genomic analyses reveal mutational signatures and frequently altered genes in esophageal squamous cell carcinoma.
25100733 2014 The RNA-editing enzyme APOBEC1 requires heterogeneous nuclear ribonucleoprotein Q isoform 6 for efficient interaction with interleukin-8 mRNA.
25085003 2014 The RNA editing enzyme APOBEC1 induces somatic mutations and a compatible mutational signature is present in esophageal adenocarcinomas.
22580899 2012 Proprotein convertase subtilisin/kexin type 9 interacts with apolipoprotein B and prevents its intracellular degradation, irrespective of the low-density lipoprotein receptor.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20348446 2010 Hypermutation induced by APOBEC-1 overexpression can be eliminated.
20331378 2010 Large-scale candidate gene analysis of spontaneous clearance of hepatitis C virus.
19965785 2010 Identification of two common variants contributing to serum apolipoprotein B levels in Mexicans.
19932086 2010 The expression of apoB mRNA editing factors is not the sole determinant for the induction of editing in differentiating Caco-2 cells.
More...