Property Summary

NCBI Gene PubMed Count 34
PubMed Score 26.25
PubTator Score 63.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.200 1.4e-04
gastric carcinoma 1.100 1.3e-02
medulloblastoma -1.200 1.1e-03
medulloblastoma, large-cell -1.200 8.1e-03
Multiple myeloma 1.501 2.1e-03
ovarian cancer -1.600 1.1e-06
pancreatic ductal adenocarcinoma liver m... 1.429 4.9e-03
Pick disease -1.200 3.5e-03
tuberculosis and treatment for 6 months 1.100 3.9e-06

Gene RIF (10)

AA Sequence

MAASTASHRPIKGILKNKTSTTSSMVASAEQPRGNVDEELSKKSQKWDEMNILATYHPADKDYGLMKIDE      1 - 70
PSTPYHSMMGDDEDACSDTEATEAMAPDILARKLAAAEGLEPKYRIQEQESSGEEDSDLSPEEREKKRQF     71 - 140
EMKRKLHYNEGLNIKLARQLISKDLHDDDEDEEMLETADGESMNTEESNQGSTPSDQQQNKLRSS         141 - 205
//

Text Mined References (40)

PMID Year Title