Property Summary

NCBI Gene PubMed Count 31
Grant Count 6
Funding $1,090,178.03
PubMed Score 25.57
PubTator Score 63.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Gene RIF (10)

PMID Text
24195737 The results show that contrary to initial observations PPP1R2-related pseudogenes are not simple bystanders of the evolutionary process but may rather be at the origin of genes with novel functions.
23506001 The potential phosphosites in PPP1R2 are substituted by non-phosphorylable residues, T73P and S87R, in PPP1R2P3.
21714498 Pin1 and phosphatase inhibitor-2 are conserved among eukaryotes from yeast to humans and make an ancient partnership that provides a means for regulating Pin1 specificity and function.
19036150 Results suggest that phosphatase inhibitor 2 localizes to the primary cilium of human retinal epithelial cells where it affects both Ser/Thr phosphorylation and is required for full tubulin acetylation.
18716057 Conserved together throughout eukaryotic evolution, I-2, PP1 and Aurora B function interdependently during mitosis.
16987514 These results indicate that the protein phosphatase-1/inhibitor-2 complex differentially regulates GSK3 dephosphorylation induced by KCl and that GSK3 activity regulates SERCA2 levels.
16627625 Studies in hamster indicate that modulation of type 1 protein phosphatase (PP1) activity by inhibitor-2 (INH-2) provides a potential new treatment for heart failure without activating protein kinase A (PKA) signaling.
12761178 first demonstration that glycogen synthase kinase-3beta associates with PP1C/I-2 complex and phosphorylates I-2 at T72 in intact cells
12393858 PP1C and Inh2 bind to KPI2 to form a regulatory complex that is localized to membranes
12221103 Inh2 can enhance the kinase activity of the Nek2.PP1C complex via inhibition of phosphatase activity to initiate centrosome separation

AA Sequence

MAASTASHRPIKGILKNKTSTTSSMVASAEQPRGNVDEELSKKSQKWDEMNILATYHPADKDYGLMKIDE      1 - 70
PSTPYHSMMGDDEDACSDTEATEAMAPDILARKLAAAEGLEPKYRIQEQESSGEEDSDLSPEEREKKRQF     71 - 140
EMKRKLHYNEGLNIKLARQLISKDLHDDDEDEEMLETADGESMNTEESNQGSTPSDQQQNKLRSS         141 - 205
//

Text Mined References (37)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
24366813 2013 Interaction proteome of human Hippo signaling: modular control of the co-activator YAP1.
24195737 2013 Not so pseudo: the evolutionary history of protein phosphatase 1 regulatory subunit 2 and related pseudogenes.
23506001 2013 Identification and characterization of two distinct PPP1R2 isoforms in human spermatozoa.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22321011 Protein phosphatase 1? interacting proteins in the human brain.
21714498 2011 Molecular basis for an ancient partnership between prolyl isomerase Pin1 and phosphatase inhibitor-2.
21269460 2011 Initial characterization of the human central proteome.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
More...