Property Summary

NCBI Gene PubMed Count 388
Grant Count 1,102
R01 Count 743
Funding $99,273,345.23
PubMed Score 1303.76
PubTator Score 1022.57

Knowledge Summary

Patent (56,218)

Expression

Synonym

Accession P41235 A5JW41 B2RPP8 O00659 O00723 Q14540 Q5QPB8 Q6B4V5 Q6B4V6 Q6B4V7 Q92653 Q92654 Q92655 Q99864 Q9NQH0 HNF-4-alpha
Symbols TCF
HNF4
MODY
FRTS4
MODY1
NR2A1
TCF14
HNF4a7
HNF4a8
HNF4a9
NR2A21
HNF4alpha

Gene

PDB

1PZL   3CBB   3FS1   4B7W   4IQR  

  TechDev Info (1)

Jun Qin Signaling network evaluation of transcript factor crosstalk via catTRE/MS

MLP Assay (7)

AID Type Active / Inconclusive / Inactive Description
2277 screening 14 / 0 / 0 Center Based Initiative to identify novel modulators of the Retinoic acid receptor-related Orphan Receptors (ROR): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors.
504934 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors
651674 screening 1736 / 0 / 513 Counterscreen for inhibitors of the interaction of the lipase co-activator protein, abhydrolase domain containing 5 (ABHD5) with perilipin-5 (MLDP; PLIN5): Luminescence-based biochemical high throughput assay to identify inhibitors of Hepatocyte nuclear factor 4 (HNF4) dimerization
651720 confirmatory 133 / 0 / 101 Counterscreen for inhibitors of the interaction of the lipase co-activator protein, abhydrolase domain containing 5 (ABHD5) with perilipin-5 (MLDP; PLIN5): Luminescence-based biochemical high throughput dose response assay to identify inhibitors of Hepatocyte nuclear factor 4 (HNF4) dimerization
651760 confirmatory 8 / 0 / 40 Late stage counterscreen for inhibitors of the interaction of the lipase co-activator protein, abhydrolase domain containing 5 (ABHD5) with perilipin-5 (MLDP; PLIN5): Luminescence-based biochemical dose response assay to identify inhibitors of Hepatocyte nuclear factor 4 (HNF4) dimerization
652123 confirmatory 15 / 0 / 33 Late stage counterscreen for inhibitors of the interaction of the lipase co-activator protein, abhydrolase domain containing 5 (ABHD5) with perilipin-5 (MLDP; PLIN5): Luminescence-based biochemical dose response assay to identify inhibitors of Hepatocyte nuclear factor 4 (HNF4) dimerization (ROUND 2)
652137 confirmatory 0 / 0 / 6 Late stage counterscreen for inhibitors of the interaction of the lipase co-activator protein, abhydrolase domain containing 5 (ABHD5) with perilipin-5 (MLDP; PLIN5): Luminescence-based biochemical dose response assay to identify inhibitors of Hepatocyte nuclear factor 4 (HNF4) dimerization (ROUND 3)

Gene RIF (358)

PMID Text
27011261 Berberine has an effect on hepatic gluconeogenesis and lipid metabolism and is mediated through HNF-4alpha and regulated downstream of miR122
26926107 ETS2, HNF4A and JUNB are synergistic master regulators of epithelial-to-mesenchymal transition in cancer.
26743282 HNF4alpha expression analysis revealed that pre-exposing the cells with FGF4 was more effective in hepatocyte differentiation.
26692490 In conclusion, our data indicate that HNF-4alpha may have a wider role in cell and plasma cholesterol homeostasis by controlling the expression of LXRalpha in hepatic cells.
26624507 PHD2 suppresses the activity of TGF-beta1 pathway and consequently maintains the expression of hepatocyte nuclear factor-4alpha
26561320 Studied the role and putative interactors of SNAI2, a slug protein which is involved in the development of cancer progression. Based upon the computational analysis, we consider HNF4A could be a putative candidate to study zinc finger protein slug.
26446475 rejected the hypothesis that all human MODY-associated mutations in HNF1A / HNF4A induce changes in the pharmacokinetics of sulfonylureas in humans analogically to the Hnf1a(-/-) mouse model
26302721 In conclusion, our study revealed a novel mechanism by which TSH regulated the hepatic HNF-4alpha subcellular localization.
26272613 These results suggest that the flavonoid luteolin ameliorates an atherogenic lipid profile in vivo that is likely to be mediated through the inactivation of HNF4alpha.
26241054 these data demonstrate that copper-mediated nuclear receptor dysfunction disrupts liver function in WD and potentially in other disorders associated with increased hepatic copper levels.
More...

AA Sequence

MRLSKTLVDMDMADYSAALDPAYTTLEFENVQVLTMGNDTSPSEGTNLNAPNSLGVSALCAICGDRATGK      1 - 70
HYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKDKRNQCRYCRLKKCFRAGMKKEAVQNERDRISTR     71 - 140
RSSYEDSSLPSINALLQAEVLSRQITSPVSGINGDIRAKKIASIADVCESMKEQLLVLVEWAKYIPAFCE    141 - 210
LPLDDQVALLRAHAGEHLLLGATKRSMVFKDVLLLGNDYIVPRHCPELAEMSRVSIRILDELVLPFQELQ    211 - 280
IDDNEYAYLKAIIFFDPDAKGLSDPGKIKRLRSQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQ    281 - 350
MIEQIQFIKLFGMAKIDNLLQEMLLGGSPSDAPHAHHPLHPHLMQEHMGTNVIVANTMPTHLSNGQMCEW    351 - 420
PRPRGQAATPETPQPSPPGGSGSEPYKLLPGAVATIVKPLSAIPQPTITKQEVI                    421 - 474
//

Text Mined References (391)

PMID Year Title
27011261 2016 Berberine Attenuates Development of the Hepatic Gluconeogenesis and Lipid Metabolism Disorder in Type 2 Diabetic Mice and in Palmitate-Incubated HepG2 Cells through Suppression of the HNF-4? miR122 Pathway.
26926107 2016 Synergistic action of master transcription factors controls epithelial-to-mesenchymal transition.
26743282 2015 Comparison of hepatic nuclear factor-4 expression in two- and three-dimensional culture of Wharton's jelly-derived cells exposed to hepatogenic medium.
26692490 2016 Transcriptional regulation of the human Liver X Receptor ? gene by Hepatocyte Nuclear Factor 4?.
26624507 2015 Prolyl-4-Hydroxylase 2 Potentially Contributes to Hepatocellular Carcinoma-Associated Erythrocytosis by Maintaining Hepatocyte Nuclear Factor-4? Expression.
26561320 2015 Is HNF4A a candidate to study zinc finger protein slug?
26446475 2015 Half-Life of Sulfonylureas in HNF1A and HNF4A Human MODY Patients is not Prolonged as Suggested by the Mouse Hnf1a(-/-) Model.
26302721 2015 Thyroid-Stimulating Hormone Increases HNF-4? Phosphorylation via cAMP/PKA Pathway in the Liver.
26272613 2015 Identification of the Flavonoid Luteolin as a Repressor of the Transcription Factor Hepatocyte Nuclear Factor 4?.
26241054 2015 Elevated copper impairs hepatic nuclear receptor function in Wilson's disease.
More...