Property Summary

Ligand Count 1
NCBI Gene PubMed Count 415
PubMed Score 1373.29
PubTator Score 1022.57

Knowledge Summary

Patent (56,218)

TINX Plot

  Disease (8)

Disease Target Count
diabetes mellitus 1728
Hypoglycemia 152
Abnormal urinary amino-acid findings 38
Abnormality of fatty-acid metabolism 6
Adult Fanconi syndrome 12
Agitation 16
Alkaline phosphatase serum increased 29
Aminoaciduria 38
Comatose 56
Diabetes Mellitus, Non-Insulin-Dependent 145
Diarrhea 253
Drowsiness 7
Dull intelligence 645
Elevated heart rate 25
Elevated hepatic transaminases 81
Epilepsy 792
Fasting Hypoglycemia 8
Fatigue 182
Fatty acids abnormal 6
Glycosuria 29
Hepatic enzyme increased 81
Hepatomegaly 285
Hyperhidrosis disorder 81
Hyperinsulinaemic hypoglycaemia 16
Hyperphosphaturia 21
Hypoketotic hypoglycemia 11
Hypophosphatemic Rickets 11
Hypouricemia 5
Increased calcium level in kidney 21
Increased liver glycogen content 3
Increased sweating 81
Intellectual disability 1016
Islets of Langerhans hyperplasia 11
Large for gestational age 11
Lethargy 77
Liver Dysfunction 99
Liver enzymes abnormal 81
Liver function test increased 81
Liver function tests abnormal finding 81
Low intelligence 645
Maturity onset diabetes mellitus in young 11
Mental Retardation 645
Mental deficiency 645
Metabolic Ketosis 3
Multicystic Dysplastic Kidney 52
Neonatal Hypotonia 64
Neonatal hypoglycemia 17
Nephrocalcinosis 35
Pallor 40
Poor school performance 645
Progressive neurologic deterioration 19
Proteinuria 144
Rickets 49
Seizures 596
Short stature 531
Subclinical abnormal liver function tests 81
Sweating 81
Tachycardia 43
Transaminases increased 81
Tremor 113
Urine phosphorous concentration above normal 21
Vomiting 116
ulcerative colitis 1819
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Lipid metabolism disorder 114 0.0 3.0
Type 2 diabetes mellitus 272 0.0 3.0
Disease Target Count Z-score Confidence
Hyperinsulinemic hypoglycemia 17 3.576 1.8

Expression

  Differential Expression (5)

Protein-protein Interaction (1)

Gene RIF (386)

AA Sequence

MRLSKTLVDMDMADYSAALDPAYTTLEFENVQVLTMGNDTSPSEGTNLNAPNSLGVSALCAICGDRATGK      1 - 70
HYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKDKRNQCRYCRLKKCFRAGMKKEAVQNERDRISTR     71 - 140
RSSYEDSSLPSINALLQAEVLSRQITSPVSGINGDIRAKKIASIADVCESMKEQLLVLVEWAKYIPAFCE    141 - 210
LPLDDQVALLRAHAGEHLLLGATKRSMVFKDVLLLGNDYIVPRHCPELAEMSRVSIRILDELVLPFQELQ    211 - 280
IDDNEYAYLKAIIFFDPDAKGLSDPGKIKRLRSQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQ    281 - 350
MIEQIQFIKLFGMAKIDNLLQEMLLGGSPSDAPHAHHPLHPHLMQEHMGTNVIVANTMPTHLSNGQMCEW    351 - 420
PRPRGQAATPETPQPSPPGGSGSEPYKLLPGAVATIVKPLSAIPQPTITKQEVI                    421 - 474
//

Text Mined References (418)

PMID Year Title