Property Summary

Ligand Count 4
NCBI Gene PubMed Count 114
PubMed Score 565.75
PubTator Score 261.97

Knowledge Summary

Patent (23,906)

TINX Plot

  Disease (5)

Expression

  Differential Expression (4)

Disease log2 FC p
acute quadriplegic myopathy -1.090 4.6e-08
esophageal adenocarcinoma -1.200 3.1e-02
osteosarcoma -1.941 9.6e-05
spina bifida -1.704 3.1e-02

Gene RIF (94)

AA Sequence

MAADLGPWNDTINGTWDGDELGYRCRFNEDFKYVLLPVSYGVVCVPGLCLNAVALYIFLCRLKTWNASTT      1 - 70
YMFHLAVSDALYAASLPLLVYYYARGDHWPFSTVLCKLVRFLFYTNLYCSILFLTCISVHRCLGVLRPLR     71 - 140
SLRWGRARYARRVAGAVWVLVLACQAPVLYFVTTSARGGRVTCHDTSAPELFSRFVAYSSVMLGLLFAVP    141 - 210
FAVILVCYVLMARRLLKPAYGTSGGLPRAKRKSVRTIAVVLAVFALCFLPFHVTRTLYYSFRSLDLSCHT    211 - 280
LNAINMAYKVTRPLASANSCLDPVLYFLAGQRLVRFARDAKPPTGPSPATPARRRLGLRRSDRTDMQRIE    281 - 350
DVLGSSEDSRRTESTPAGSENTKDIRL                                               351 - 377
//

Text Mined References (115)

PMID Year Title