Property Summary

Ligand Count 20
NCBI Gene PubMed Count 114
PubMed Score 565.75
PubTator Score 261.97

Knowledge Summary

Patent (23,906)

TINX Plot

  Disease (5)

Expression

  Differential Expression (4)

Disease log2 FC p
acute quadriplegic myopathy -1.090 4.6e-08
esophageal adenocarcinoma -1.200 3.1e-02
osteosarcoma -1.941 9.6e-05
spina bifida -1.704 3.1e-02

Gene RIF (94)

AA Sequence

MAADLGPWNDTINGTWDGDELGYRCRFNEDFKYVLLPVSYGVVCVPGLCLNAVALYIFLCRLKTWNASTT      1 - 70
YMFHLAVSDALYAASLPLLVYYYARGDHWPFSTVLCKLVRFLFYTNLYCSILFLTCISVHRCLGVLRPLR     71 - 140
SLRWGRARYARRVAGAVWVLVLACQAPVLYFVTTSARGGRVTCHDTSAPELFSRFVAYSSVMLGLLFAVP    141 - 210
FAVILVCYVLMARRLLKPAYGTSGGLPRAKRKSVRTIAVVLAVFALCFLPFHVTRTLYYSFRSLDLSCHT    211 - 280
LNAINMAYKVTRPLASANSCLDPVLYFLAGQRLVRFARDAKPPTGPSPATPARRRLGLRRSDRTDMQRIE    281 - 350
DVLGSSEDSRRTESTPAGSENTKDIRL                                               351 - 377
//

Text Mined References (115)

PMID Year Title