Property Summary

NCBI Gene PubMed Count 106
Grant Count 232
R01 Count 143
Funding $26,841,144.23
PubMed Score 543.08
PubTator Score 261.97

Knowledge Summary

Patent (23,906)

Expression

  Differential Expression (4)

Disease log2 FC p
esophageal adenocarcinoma -1.200 0.031
osteosarcoma -1.941 0.000
acute quadriplegic myopathy -1.090 0.000
spina bifida -1.704 0.031

Synonym

Accession P41231 B2R9W3 Q96EM8 P2Y2
Symbols P2U
HP2U
P2U1
P2UR
P2Y2
P2RU1
P2Y2R

Gene

PANTHER Protein Class (2)

PDB

1Z8E  

  TechDev Info (1)

Gene RIF (86)

PMID Text
26996596 Data show that the purinergic receptor P2Y2 (P2Y2R) pepducin activates neutrophils through formyl peptide receptor 2 (FPR2), and ATP is turned into an activating agonist through a receptor cross-talk mechanism that involves both FPR2 and P2Y2R.
26631725 Activation of P2Y2R increased TF promoter activity and mRNA expression in coronary artery endothelial cells.
26443721 The P2RY2 receptor induces carcinoma cell migration and epithelial-mesenchymal transition through cross-talk with EGFR.
26182292 P2Y2 receptor and EGFR cooperate to promote prostate cancer cell invasion via ERK1/2 pathway.
26168216 P2Y2 and Gq/G11 are required for basal endothelial NO formation, vascular tone, and blood pressure.
26063340 These results suggest that over-activated ERK and PKC pathways are involved in the P2Y2R-mediated invasion of breast cancer cells.
25937122 Data indicate that ATP-evoked Hoechst 33258 uptake was dependent on activation of P2Y receptors P2Y1 and P2Y2.
25807824 Signaling cascades evoked by P2Y2 receptor plays an important role in the phenomena dependent on the actin cytoskeleton dynamics endocy-tosis, cell division, adhesion, intracellular transport and migration.(review)
25713410 These results indicate that B2R couples with P2Y2R and that these G-protein-coupled receptors act together to fine-tune cellular responsiveness.
25575516 ATP increased P2Y-mediated upregulation of MUC8 expression; however, IL-1alpha significantly decreased the extent to which ATP/P2Y upregulated MUC8 expression.
More...

AA Sequence

MAADLGPWNDTINGTWDGDELGYRCRFNEDFKYVLLPVSYGVVCVPGLCLNAVALYIFLCRLKTWNASTT      1 - 70
YMFHLAVSDALYAASLPLLVYYYARGDHWPFSTVLCKLVRFLFYTNLYCSILFLTCISVHRCLGVLRPLR     71 - 140
SLRWGRARYARRVAGAVWVLVLACQAPVLYFVTTSARGGRVTCHDTSAPELFSRFVAYSSVMLGLLFAVP    141 - 210
FAVILVCYVLMARRLLKPAYGTSGGLPRAKRKSVRTIAVVLAVFALCFLPFHVTRTLYYSFRSLDLSCHT    211 - 280
LNAINMAYKVTRPLASANSCLDPVLYFLAGQRLVRFARDAKPPTGPSPATPARRRLGLRRSDRTDMQRIE    281 - 350
DVLGSSEDSRRTESTPAGSENTKDIRL                                               351 - 377
//

Text Mined References (107)

PMID Year Title
26996596 2016 A pepducin designed to modulate P2Y2R function interacts with FPR2 in human neutrophils and transfers ATP to an NADPH-oxidase-activating ligand through a receptor cross-talk mechanism.
26631725 2016 Purinergic P2Y2 Receptor Control of Tissue Factor Transcription in Human Coronary Artery Endothelial Cells: NEW AP-1 TRANSCRIPTION FACTOR SITE AND NEGATIVE REGULATOR.
26443721 2016 The P2RY2 Receptor Induces Carcinoma Cell Migration and EMT Through Cross-Talk With Epidermal Growth Factor Receptor.
26182292 2015 P2Y2 Receptor and EGFR Cooperate to Promote Prostate Cancer Cell Invasion via ERK1/2 Pathway.
26168216 2015 P2Y? and Gq/G?? control blood pressure by mediating endothelial mechanotransduction.
26063340 2015 P2Y2 nucleotide receptor-mediated extracellular signal-regulated kinases and protein kinase C activation induces the invasion of highly metastatic breast cancer cells.
25937122 2015 Selective permeabilization of cervical cancer cells to an ionic DNA-binding cytotoxin by activation of P2Y receptors.
25807824 2014 [Nucleotide receptors and actin cytoskeleton dynamics].
25713410 2015 Close association of B2 bradykinin receptors with P2Y2 ATP receptors.
25575516 2015 Silencing of MUC8 by siRNA increases P2Y?-induced airway inflammation.
More...