Property Summary

NCBI Gene PubMed Count 72
Grant Count 33
R01 Count 13
Funding $2,859,112.36
PubMed Score 236.18
PubTator Score 160.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.295 0.000
colon cancer 1.100 0.026
lung cancer 1.100 0.002
non primary Sjogren syndrome sicca 1.100 0.024
ovarian cancer 1.700 0.000

Gene RIF (53)

PMID Text
26755727 there is no difference in lysine acetylation of substrate proteins with or without Naa10, suggesting that the substrates may be acetylated chemically rather than enzymatically.
26646451 The results observed an inverse correlation between the expression of NAA10 and that of miR-342-5p and miR-608 .
26522270 The clinical spectrum of NAA10.
25987439 Naa10 structure and function. [Review]
25854368 Combined high expression of Naa10p, SNCG and PRL-3 are associated with lymph node metastasis in breast cancer.
25421966 human ARD1 variants have different effects on cell proliferation, which may result from distinct subcellular localizations and autoacetylation activities.
25341044 ARD1 has a crucial role in the cellular response to oxidative stress as a bona fide regulator of MSRA.
25338643 Autoacetylation of ARD1 variants differentially regulates angiogenesis and cell proliferation in an isoform-specific manner.
25133627 results show that hARD1 nuclear translocation mediated by NLS is required for cell cycle progression, thereby contributing to proper cell proliferation.
25099252 De novo missense mutations in the NAA10 gene cause severe non-syndromic developmental delay in males and females
More...

AA Sequence

MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKMEEDPDDVPHG      1 - 70
HITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALHLYSNTLNFQISEVEPKYYAD     71 - 140
GEDAYAMKRDLTQMADELRRHLELKEKGRHVVLGAIENKVESKGNSPPSSGEACREEKGLAAEDSGGDSK    141 - 210
DLSEVSETTESTDVKDSSEASDSAS                                                 211 - 235
//

Text Mined References (78)

PMID Year Title
26755727 2016 The N-terminal Acetyltransferase Naa10/ARD1 Does Not Acetylate Lysine Residues.
26646451 2016 microRNA-342-5p and miR-608 inhibit colon cancer tumorigenesis by targeting NAA10.
26522270 2015 NAA10 mutation causing a novel intellectual disability syndrome with Long QT due to N-terminal acetyltransferase impairment.
25987439 2015 The biological functions of Naa10 - From amino-terminal acetylation to human disease.
25854368 2015 Combined expression of metastasis related markers Naa10p, SNCG and PRL-3 and its prognostic value in breast cancer patients.
25421966 2015 Different subcellular localizations and functions of human ARD1 variants.
25416956 2014 A proteome-scale map of the human interactome network.
25341044 2014 Arrest defective 1 regulates the oxidative stress response in human cells and mice by acetylating methionine sulfoxide reductase A.
25338643 2015 Autoacetylation regulates differentially the roles of ARD1 variants in tumorigenesis.
25133627 2014 Nuclear translocation of hARD1 contributes to proper cell cycle progression.
More...