Property Summary

NCBI Gene PubMed Count 116
PubMed Score 410.94
PubTator Score 919.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Bipolar Disorder 666
Schizophrenia 1160

Expression

  Differential Expression (32)

Protein-protein Interaction (1)

Gene RIF (79)

AA Sequence

MATHHTLWMGLALLGVLGDLQAAPEAQVSVQPNFQQDKFLGRWFSAGLASNSSWLREKKAALSMCKSVVA      1 - 70
PATDGGLNLTSTFLRKNQCETRTMLLQPAGSLGSYSYRSPHWGSTYSVSVVETDYDQYALLYSQGSKGPG     71 - 140
EDFRMATLYSRTQTPRAELKEKFTAFCKAQGFTEDTIVFLPQTDKCMTEQ                        141 - 190
//

Text Mined References (123)

PMID Year Title