Property Summary

NCBI Gene PubMed Count 113
PubMed Score 391.33
PubTator Score 919.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 7.11387598654445E-18
atypical teratoid/rhabdoid tumor 1095 5.45570089946234E-16
adrenocortical carcinoma 1427 3.27158693993432E-12
malignant mesothelioma 3163 7.79898857793161E-10
group 4 medulloblastoma 1875 6.14715813647749E-9
lung cancer 4473 1.02787560357212E-6
oligodendroglioma 2849 1.75617218856169E-6
medulloblastoma, large-cell 6234 2.30818056274751E-6
Duchenne muscular dystrophy 602 3.81788927768755E-5
lung adenocarcinoma 2714 7.7167884679415E-5
glioblastoma 5572 1.08739274104069E-4
primitive neuroectodermal tumor 3031 1.53531913288701E-4
ovarian cancer 8492 2.98548024143267E-4
pediatric high grade glioma 2712 2.99595265204439E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 3.42122683394358E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 7.548686348707E-4
limb girdle muscular dystrophy 2I 56 7.78710479940423E-4
ulcerative colitis 2087 0.00206975350319836
Becker muscular dystrophy 187 0.00217896140699559
primary pancreatic ductal adenocarcinoma 1271 0.00281710149777791
pituitary cancer 1972 0.00306329313961077
primary Sjogren syndrome 789 0.00975000851334061
pancreatic cancer 2300 0.01208192748914
pancreatic carcinoma 567 0.01208192748914
invasive ductal carcinoma 2950 0.0161669356618064
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0167730387424303
Atopic dermatitis 944 0.017529780747691
interstitial cystitis 2299 0.0176464080451066
ependymoma 2514 0.0267887150969079
pilocytic astrocytoma 3086 0.0283532354648965
adrenocortical adenoma 134 0.0294553743578313

Expression

Synonym

Accession P41222 B2R727 Q5SQ10 Q7M4P3 Q9UC22 Q9UCC9 Q9UCD9
Symbols PDS
PGD2
PGDS
LPGDS
PGDS2
L-PGDS

Gene

PANTHER Protein Class (1)

PDB

2WWP   3O19   3O22   3O2Y   4IMN   4IMO   4ORR   4ORS   4ORU   4ORW   4ORX   4ORY   4OS0   4OS3   4OS8  

  Ortholog (9)

Species Source
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG Inparanoid

Gene RIF (76)

PMID Text
26800100 BTP and B2M levels are less affected than serum by amputation, and should be considered for future study of GFR estimation
26469385 HIV-1 MA increases PTGDS mRNA expression in HepG2 cells
26431580 Hematopoietic prostaglandin D synthase defines a proeosinophilic pathogenic effector human T(H)2 cell subpopulation with enhanced function
26211517 Given that uPGDS levels fall after treatment of LN, uPGDS may be used to monitor the efficacy of therapy. It can also differentiate patients with active nephritis and active non renal lupus.
25966493 Expression of MR and prostaglandin D2 synthase is strongly correlated in adipose tissues from obese patients.
25964109 levels of L-PGDS in cervicovaginal secretions of pregnant women at different stages of parturition correlate with preterm birth.
25522430 PTGDS mRNA expression was down-regulated in rapid-cycling bipolar disorder patients in a euthymic, depressive, and manic/hypomanic state compared with healthy control subjects.
25005874 These results suggest that L-PGDS acted as a scavenger of biliverdin, which is a molecule not found in normal CSF.
24521203 involved in pathogenesis of androgenetic alopecia [review]
24493589 Lipocalin-type prostaglandin D2 (PGD2) synthase (L-PGDS) interacts intracellularly with the G protein-coupled receptor DP1 in an agonist-independent manner.
More...

AA Sequence

MATHHTLWMGLALLGVLGDLQAAPEAQVSVQPNFQQDKFLGRWFSAGLASNSSWLREKKAALSMCKSVVA      1 - 70
PATDGGLNLTSTFLRKNQCETRTMLLQPAGSLGSYSYRSPHWGSTYSVSVVETDYDQYALLYSQGSKGPG     71 - 140
EDFRMATLYSRTQTPRAELKEKFTAFCKAQGFTEDTIVFLPQTDKCMTEQ                        141 - 190
//

Text Mined References (120)

PMID Year Title
26800100 2015 Effects of Traumatic Amputation on ?-Trace Protein and ?2-Microglobulin Concentrations in Male Soldiers.
26431580 2016 Hematopoietic prostaglandin D synthase defines a proeosinophilic pathogenic effector human T(H)2 cell subpopulation with enhanced function.
26211517 Urinary prostaglandin D synthase as biomarker in lupus nephritis: a longitudinal study.
25966493 2015 Adipocyte Mineralocorticoid Receptor Activation Leads to Metabolic Syndrome and Induction of Prostaglandin D2 Synthase.
25964109 Role of Lipocalin-type prostaglandin D2 synthase (L-PGDS) and its metabolite, prostaglandin D2, in preterm birth.
25522430 2014 Reduced mRNA expression of PTGDS in peripheral blood mononuclear cells of rapid-cycling bipolar disorder patients compared with healthy control subjects.
25416956 2014 A proteome-scale map of the human interactome network.
25005874 2014 Lipocalin-type prostaglandin D synthase scavenges biliverdin in the cerebrospinal fluid of patients with aneurysmal subarachnoid hemorrhage.
24521203 2014 Does prostaglandin D2 hold the cure to male pattern baldness?
24493589 2014 A G protein-coupled receptor and the intracellular synthase of its agonist functionally cooperate.
More...