Property Summary

NCBI Gene PubMed Count 267
PubMed Score 587.38
PubTator Score 418.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
posterior fossa group A ependymoma 1511 6.79557946412937E-18
astrocytoma 1493 1.7377977714677E-12
psoriasis 6685 4.83910511227157E-12
ovarian cancer 8492 1.28088995847788E-10
pilocytic astrocytoma 3086 1.1750580602197E-8
non-small cell lung cancer 2798 9.18572540416427E-8
ulcerative colitis 2087 7.00487415734277E-7
glioblastoma 5572 1.1689671631602E-6
Atopic dermatitis 944 1.02315891758416E-5
pediatric high grade glioma 2712 1.29053091759143E-5
tuberculosis and treatment for 3 months 327 2.2403652789034E-5
osteosarcoma 7933 1.25334367719696E-4
atypical teratoid/rhabdoid tumor 1095 1.57206280694534E-4
sonic hedgehog group medulloblastoma 1482 1.79602550650419E-4
cystic fibrosis 1670 3.78925363784769E-4
invasive ductal carcinoma 2950 5.77434227511941E-4
head and neck cancer and chronic obstructive pulmonary disease 237 8.70617468056313E-4
pancreatic cancer 2300 0.00139705456366474
fibroadenoma 557 0.00169505974748639
breast carcinoma 1614 0.00191520653354012
ductal carcinoma in situ 1745 0.00208302879446627
cutaneous lupus erythematosus 1056 0.00291390578052702
head and neck cancer 270 0.00347041081754654
interstitial cystitis 2299 0.00564181728645401
Hydrolethalus syndrome 128 0.00622881614668798
Breast cancer 3099 0.00777832101527824
medulloblastoma, large-cell 6234 0.0246380325345285
Disease Target Count Z-score Confidence
Cancer 2346 4.796 2.4
Cleft palate 125 3.014 1.5

Expression

Synonym

Accession P41221 A8K4A4 Q6P278
Symbols hWNT5A

Gene

PANTHER Protein Class (1)

  Ortholog (7)

Species Source
Chimp OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Anole lizard OMA Inparanoid
C. elegans OMA Inparanoid

Gene RIF (244)

PMID Text
26997628 Wnt5a is increased and beta-catenin is decreased in parenchyma from idiopathic pulmonary fibrosis patients.
26978652 Epigenetic inactivation of the WNT5A promoter B involves both DNA methylation and histone modifications. Differential expression of the WNT5A alternative promoters A and B is a characteristic of osteosarcomas.
26848991 Studied the roles of WNT4 and WNT5A in human decidulization and their relationship with preeclampsia.
26800561 Noncanonical Wnt5a signaling and JNK activity contribute to vascular insulin resistance and endothelial dysfunction.
26794322 Mutation in WNT5A may serve as a susceptibility factor for Congenital Anomalies Of Kidney And Urinary Tract.
26708384 Wnt5a-Ror2 signaling enhances expression and secretion of CXCL16 in mesenchymal stem cells thereby activating CXCR6 expressed on tumor cells to promote proliferation.
26708300 these findings suggest that miR154 functions as a tumor suppressor in osteosarcoma by partially suppressing Wnt5a expression.
26690702 This study identifies an interaction between ROR1 and ROR2 that is required for Wnt5a signaling that promotes leukemia chemotaxis and proliferation.
26648282 Wnt5a is involved in the modulation of pancreatic cancer cell proliferation.
26596412 results corroborated previous findings of Ryk-mediated Wnt5a effect, and suggested a role for Ror2 in the Wnt5a machinery in glioblastoma
More...

AA Sequence

MKKSIGILSPGVALGMAGSAMSSKFFLVALAIFFSFAQVVIEANSWWSLGMNNPVQMSEVYIIGAQPLCS      1 - 70
QLAGLSQGQKKLCHLYQDHMQYIGEGAKTGIKECQYQFRHRRWNCSTVDNTSVFGRVMQIGSRETAFTYA     71 - 140
VSAAGVVNAMSRACREGELSTCGCSRAARPKDLPRDWLWGGCGDNIDYGYRFAKEFVDARERERIHAKGS    141 - 210
YESARILMNLHNNEAGRRTVYNLADVACKCHGVSGSCSLKTCWLQLADFRKVGDALKEKYDSAAAMRLNS    211 - 280
RGKLVQVNSRFNSPTTQDLVYIDPSPDYCVRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDQFKTV    281 - 350
QTERCHCKFHWCCYVKCKKCTEIVDQFVCK                                            351 - 380
//

Text Mined References (267)

PMID Year Title
26997628 2016 Aberrant nonfibrotic parenchyma in idiopathic pulmonary fibrosis is correlated with decreased ?-catenin inhibition and increased Wnt5a/b interaction.
26978652 2016 Inactivation of the WNT5A Alternative Promoter B Is Associated with DNA Methylation and Histone Modification in Osteosarcoma Cell Lines U2OS and SaOS-2.
26848991 2016 Dysfunction of WNT4/WNT5A in deciduas: possible relevance to the pathogenesis of preeclampsia.
26800561 2016 Endothelial Dysfunction in Human Diabetes Is Mediated by Wnt5a-JNK Signaling.
26794322 2016 Wnt5a Deficiency Leads to Anomalies in Ureteric Tree Development, Tubular Epithelial Cell Organization and Basement Membrane Integrity Pointing to a Role in Kidney Collecting Duct Patterning.
26708384 2016 Wnt5a-Ror2 signaling in mesenchymal stem cells promotes proliferation of gastric cancer cells by activating CXCL16-CXCR6 axis.
26708300 2016 MicroRNA-154 functions as a tumor suppressor in osteosarcoma by targeting Wnt5a.
26690702 2016 Wnt5a induces ROR1/ROR2 heterooligomerization to enhance leukemia chemotaxis and proliferation.
26648282 2016 Upregulation of the expression of Wnt5a promotes the proliferation of pancreatic cancer cells in vitro and in a nude mouse model.
26596412 2015 Wnt5a, Ryk and Ror2 expression in glioblastoma subgroups.
More...