Property Summary

NCBI Gene PubMed Count 126
Grant Count 166
R01 Count 119
Funding $19,193,790.2
PubMed Score 240.84
PubTator Score 168.08

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P41220 Q6I9U5 RGS2
Symbols G0S8

Gene

PANTHER Protein Class (2)

PDB

2AF0   2V4Z   4EKC   4EKD  

Gene RIF (112)

PMID Text
25970626 FBXO44-mediated degradation of RGS2 protein uniquely depends on a Cul4B/DDB1 complex.
25849301 The RGS2 (-391, C>G) genetic polymorphism may serve as a biomarker to predict a patient's response to antihypertensive drug therapy
25847876 MIR4717 regulates human RGS2 and contributes to the genetic risk towards anxiety-related traits.
25766235 study found that wild-type Met-Gln-Rgs2 and its mutant, Met-Arg-Rgs2, were destroyed by the Ac/N-end rule pathway, which recognizes N(alpha)-terminally acetylated (Nt-acetylated) proteins
25740197 RGS2 polymorphisms were found to be associated with anxiety disorders and dimensional as well as intermediate phenotypes of anxiety.
25664600 RGS2 localizes to the mitotic spindle in a Nek7-dependent manner, and along with Nek7 contributes to spindle morphology and mitotic spindle pole integrity.
25613138 The gene expression of RGS2 is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
25509855 The results of this study are consistent previous results and support the hypothesis that polymorphic loci RGS2 gene associated with risk of extrapyramidal symptoms induced by typicalneuroleptics-haloperidol, and are involved in schizophrenia pathway.
25368964 genetic variations and increased inflammatory cytokines can lead to RGS2 repression, which exacerbates AHR and airway remodeling in asthma.
25323766 Epigenetic repression of RGS2 by UHRF1 contributes to bladder cancer progression. UHRF1 inhibits RGS2 expression by increasing the methylation of CpG nucleotides of the RGS2 promoter.
More...

AA Sequence

MQSAMFLAVQHDCRPMDKSAGSGHKSEEKREKMKRTLLKDWKTRLSYFLQNSSTPGKPKTGKKSKQQAFI      1 - 70
KPSPEEAQLWSEAFDELLASKYGLAAFRAFLKSEFCEENIEFWLACEDFKKTKSPQKLSSKARKIYTDFI     71 - 140
EKEAPKEINIDFQTKTLIAQNIQEATSGCFTTAQKRVYSLMENNSYPRFLESEFYQDLCKKPQITTEPHA    141 - 210
T//

Text Mined References (129)

PMID Year Title
25970626 2015 FBXO44-Mediated Degradation of RGS2 Protein Uniquely Depends on a Cullin 4B/DDB1 Complex.
25849301 2015 The RGS2 (-391, C>G) genetic variation correlates to antihypertensive drug responses in Chinese patients with essential hypertension.
25847876 2015 MicroRNA hsa-miR-4717-5p regulates RGS2 and may be a risk factor for anxiety-related traits.
25766235 2015 Control of mammalian G protein signaling by N-terminal acetylation and the N-end rule pathway.
25740197 2015 RGS2 ggenetic variation: association analysis with panic disorder and dimensional as well as intermediate phenotypes of anxiety.
25664600 2015 Human Nek7-interactor RGS2 is required for mitotic spindle organization.
25509855 [Polymorphism of RGS2 gene: genetic markers of risk for schizophrenia and pharmacogenetic markers of typical neuroleptics efficiency].
25416956 2014 A proteome-scale map of the human interactome network.
25368964 2015 Regulator of G-protein signaling 2 repression exacerbates airway hyper-responsiveness and remodeling in asthma.
25323766 2015 Epigenetic repression of regulator of G-protein signaling 2 by ubiquitin-like with PHD and ring-finger domain 1 promotes bladder cancer progression.
More...