Property Summary

NCBI Gene PubMed Count 132
PubMed Score 251.20
PubTator Score 168.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Malaria 160 0.0 1.4

Expression

  Differential Expression (29)

Disease log2 FC p
active ulcerative colitis 2.147 4.4e-02
acute quadriplegic myopathy 1.703 6.0e-04
adrenocortical carcinoma -2.064 1.5e-03
autosomal dominant Emery-Dreifuss muscul... 2.146 4.2e-03
Breast cancer -5.000 1.2e-28
breast carcinoma -1.700 5.5e-04
chronic lymphosyte leukemia -2.500 1.4e-06
colon cancer -2.700 1.5e-02
cystic fibrosis 1.733 4.0e-06
dermatomyositis 2.800 1.3e-03
Duchenne muscular dystrophy 1.716 9.9e-06
ependymoma -1.500 6.0e-05
glioblastoma 2.100 1.7e-02
group 4 medulloblastoma -2.200 1.4e-05
head and neck cancer -1.100 2.8e-02
intraductal papillary-mucinous adenoma (... -2.800 2.2e-03
intraductal papillary-mucinous carcinoma... -2.900 5.2e-03
intraductal papillary-mucinous neoplasm ... -3.800 2.3e-03
limb girdle muscular dystrophy 2A 1.302 2.3e-03
lung adenocarcinoma -1.700 6.7e-07
lung cancer -1.700 5.7e-04
lung carcinoma -2.000 1.0e-15
malignant mesothelioma -5.300 5.9e-10
medulloblastoma, large-cell -2.700 7.7e-04
non primary Sjogren syndrome sicca -1.200 2.4e-02
non-small cell lung cancer -1.675 2.1e-16
oligodendroglioma -1.100 5.0e-02
ovarian cancer -3.300 1.3e-07
subependymal giant cell astrocytoma 2.244 4.8e-02

Protein-protein Interaction (10)

Gene RIF (117)

AA Sequence

MQSAMFLAVQHDCRPMDKSAGSGHKSEEKREKMKRTLLKDWKTRLSYFLQNSSTPGKPKTGKKSKQQAFI      1 - 70
KPSPEEAQLWSEAFDELLASKYGLAAFRAFLKSEFCEENIEFWLACEDFKKTKSPQKLSSKARKIYTDFI     71 - 140
EKEAPKEINIDFQTKTLIAQNIQEATSGCFTTAQKRVYSLMENNSYPRFLESEFYQDLCKKPQITTEPHA    141 - 210
T//

Text Mined References (136)

PMID Year Title