Property Summary

NCBI Gene PubMed Count 39
PubMed Score 3.00
PubTator Score 216.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma 1.700 1.1e-02
atypical teratoid / rhabdoid tumor 2.200 3.4e-03
colon cancer -3.200 1.6e-03
glioblastoma 1.400 2.5e-04
medulloblastoma 1.500 4.0e-02
medulloblastoma, large-cell 2.000 2.0e-05
Multiple myeloma -1.059 1.2e-05
osteosarcoma 1.987 1.1e-03
posterior fossa group A ependymoma 1.600 7.4e-04
psoriasis -1.200 8.2e-26

Gene RIF (18)

AA Sequence

MSHHPSGLRAGFSSTSYRRTFGPPPSLSPGAFSYSSSSRFSSSRLLGSASPSSSVRLGSFRSPRAGAGAL      1 - 70
LRLPSERLDFSMAEALNQEFLATRSNEKQELQELNDRFANFIEKVRFLEQQNAALRGELSQARGQEPARA     71 - 140
DQLCQQELRELRRELELLGRERDRVQVERDGLAEDLAALKQRLEEETRKREDAEHNLVLFRKDVDDATLS    141 - 210
RLELERKIESLMDEIEFLKKLHEEELRDLQVSVESQQVQQVEVEATVKPELTAALRDIRAQYESIAAKNL    211 - 280
QEAEEWYKSKYADLSDAANRNHEALRQAKQEMNESRRQIQSLTCEVDGLRGTNEALLRQLRELEEQFALE    281 - 350
AGGYQAGAARLEEELRQLKEEMARHLREYQELLNVKMALDIEIATYRKLLEGEESRISVPVHSFASLNIK    351 - 420
TTVPEVEPPQDSHSRKTVLIKTIETRNGEVVTESQKEQRSELDKSSAHSY                        421 - 470
//

Text Mined References (41)

PMID Year Title