Property Summary

NCBI Gene PubMed Count 23
Grant Count 10
Funding $1,375,748.17
PubMed Score 35.44
PubTator Score 38.04

Knowledge Summary

Patent

No data available

Expression

Gene RIF (9)

PMID Text
24925224 these data support the inclusion of MNDA in the diagnostic evaluation of extramedullary B-cell lymphomas, particularly those in which the differential diagnosis is between low-grade follicular lymphoma and marginal zone lymphoma.
24557068 Studied the HIN domain of recombinant myeloid nuclear differentiation antigen (MNDA).
23383108 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 downregulates the expression of myeloid cell nuclear differentiation antigen (MNDA) in peptide-treated PBMCs
20595294 Observational study of gene-disease association. (HuGE Navigator)
20193116 Myeloid antigen expression is a predictor of a poor response to chemotherapy, and an adverse prognostic factor in adult T-lymphoblastic lymphoma, but not in children with T-LBL.
19474799 MNDA expression is a useful tool for the recognition of nodal marginal zone lymphoma
16651415 MNDA has a role regulating programmed cell death in myeloid progenitor cells, and that its down-regulation in myelodysplastic syndromes is related to granulocyte-macrophage progenitor cell sensitivity to TRAIL-induced programmed cell death.
15778972 variation in MNDA expression appeared to change with phenotypic specialization of monocytes in atherosclerosis consistent with its association with inflammation and suspected roles in regulating gene expression or in mediating cell death
12112016 Retroviral mediated expression of the human myeloid nuclear antigen in a null cell line upregulates Dlk1 expression

AA Sequence

MVNEYKKILLLKGFELMDDYHFTSIKSLLAYDLGLTTKMQEEYNRIKITDLMEKKFQGVACLDKLIELAK      1 - 70
DMPSLKNLVNNLRKEKSKVAKKIKTQEKAPVKKINQEEVGLAAPAPTARNKLTSEARGRIPVAQKRKTPN     71 - 140
KEKTEAKRNKVSQEQSKPPGPSGASTSAAVDHPPLPQTSSSTPSNTSFTPNQETQAQRQVDARRNVPQND    141 - 210
PVTVVVLKATAPFKYESPENGKSTMFHATVASKTQYFHVKVFDINLKEKFVRKKVITISDYSECKGVMEI    211 - 280
KEASSVSDFNQNFEVPNRIIEIANKTPKISQLYKQASGTMVYGLFMLQKKSVHKKNTIYEIQDNTGSMDV    281 - 350
VGSGKWHNIKCEKGDKLRLFCLQLRTVDRKLKLVCGSHSFIKVIKAKKNKEGPMNVN                 351 - 407
//

Text Mined References (23)

PMID Year Title
24925224 2014 Myeloid cell nuclear differentiation antigen is expressed in a subset of marginal zone lymphomas and is useful in the differential diagnosis with follicular lymphoma.
24557068 2014 Purification, characterization and docking studies of the HIN domain of human myeloid nuclear differentiation antigen (MNDA).
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
20595294 2010 Association of IFI200 gene polymorphisms with susceptibility to systemic lupus erythematosus.
20193116 2010 Significance of myeloid antigen expression in precursor T lymphoblastic lymphoma.
19474799 2009 Identification of MNDA as a new marker for nodal marginal zone lymphoma.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17875758 2007 ATM, CTLA4, MNDA, and HEM1 in high versus low CD38 expressing B-cell chronic lymphocytic leukemia.
More...