Property Summary

NCBI Gene PubMed Count 26
PubMed Score 36.00
PubTator Score 38.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Disease log2 FC p
adrenocortical carcinoma -1.560 3.0e-02
adult high grade glioma 1.300 4.7e-02
aldosterone-producing adenoma -1.324 2.5e-02
Astrocytoma, Pilocytic 1.800 1.9e-05
chronic lymphosyte leukemia -1.300 7.6e-03
cutaneous lupus erythematosus 2.100 2.2e-03
dermatomyositis 3.100 1.0e-03
gastric carcinoma 2.200 1.3e-02
glioblastoma 1.400 6.2e-03
head and neck cancer -1.800 3.6e-02
interstitial cystitis 2.300 9.7e-03
intraductal papillary-mucinous adenoma (... -2.000 1.0e-02
intraductal papillary-mucinous carcinoma... -2.400 5.3e-03
intraductal papillary-mucinous neoplasm ... -2.400 2.7e-02
invasive ductal carcinoma 1.571 8.4e-05
lung adenocarcinoma -1.639 5.9e-04
lung cancer -3.700 1.6e-04
lung carcinoma -2.300 1.3e-19
medulloblastoma -1.100 3.5e-02
medulloblastoma, large-cell -1.700 6.5e-03
non-small cell lung cancer -2.426 6.6e-21
osteosarcoma -3.250 2.8e-03
ovarian cancer -6.100 7.6e-19
posterior fossa group A ependymoma 1.200 3.7e-03
primary Sjogren syndrome 1.900 3.6e-04
psoriasis 1.500 6.6e-07
tuberculosis 3.100 1.5e-06
ulcerative colitis 4.000 2.1e-05

 GO Function (1)

Gene RIF (10)

AA Sequence

MVNEYKKILLLKGFELMDDYHFTSIKSLLAYDLGLTTKMQEEYNRIKITDLMEKKFQGVACLDKLIELAK      1 - 70
DMPSLKNLVNNLRKEKSKVAKKIKTQEKAPVKKINQEEVGLAAPAPTARNKLTSEARGRIPVAQKRKTPN     71 - 140
KEKTEAKRNKVSQEQSKPPGPSGASTSAAVDHPPLPQTSSSTPSNTSFTPNQETQAQRQVDARRNVPQND    141 - 210
PVTVVVLKATAPFKYESPENGKSTMFHATVASKTQYFHVKVFDINLKEKFVRKKVITISDYSECKGVMEI    211 - 280
KEASSVSDFNQNFEVPNRIIEIANKTPKISQLYKQASGTMVYGLFMLQKKSVHKKNTIYEIQDNTGSMDV    281 - 350
VGSGKWHNIKCEKGDKLRLFCLQLRTVDRKLKLVCGSHSFIKVIKAKKNKEGPMNVN                 351 - 407
//

Text Mined References (26)

PMID Year Title