Property Summary

NCBI Gene PubMed Count 77
Grant Count 51
R01 Count 11
Funding $5,326,415.85
PubMed Score 319.59
PubTator Score 194.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Gene RIF (69)

PMID Text
26763359 CD200 expression is a useful marker for evaluation of the severity of PCM and that lack of CD200 expression may improve the sensitivity of PCM to therapy with new drugs.
26670206 CD200 signaling may play a key role in regulating macrophage polarization toward anti-inflammatory phenotypes
26338961 Suggest CD200 as both prognostic factor and potential therapeutic target AML, aiming to reverse the "do not eat me" signal of CD200 or to manipulate the suppressive immune microenvironment induced by CD200 binding to its receptor.
26137961 our study confirms that CD200/BTLA deletions are recurrent genetic lesions in the biology of BCP-ALL
26123445 CD200-CD200R1 signaling may be required for human pregnancy success.
25791119 the combination of CD200 and CD148 may have a potential differential diagnostic value in leukemic B-CLPDs, especially between CLL and MCL.
25778329 Prognostic value of CD200 detected in malignant ascites from patients with metastatic ovarian, endometrial and breast neoplasms remains to be elucidated.
25470765 CD160 and CD200 are expressed in B cells in chronic lymphocytic leukemia and are absent in other mature B-cell neoplasms.
25389338 staining by flow cytometry can be useful in the differential diagnosis of B-cell neoplasms and in their detection in the bone marrow
25261692 The proportion of CD200+ cells in PBMCs, peripheral CD14+ cells and CD4+ T cells was significantly lower in rheumatoid arthritis patients compared to controls, whereas the number of CD200+ cells was higher in synovium from RA patients than from controls.
More...

AA Sequence

MERLVIRMPFSHLSTYSLVWVMAAVVLCTAQVQVVTQDEREQLYTPASLKCSLQNAQEALIVTWQKKKAV      1 - 70
SPENMVTFSENHGVVIQPAYKDKINITQLGLQNSTITFWNITLEDEGCYMCLFNTFGFGKISGTACLTVY     71 - 140
VQPIVSLHYKFSEDHLNITCSATARPAPMVFWKVPRSGIENSTVTLSHPNGTTSVTSILHIKDPKNQVGK    141 - 210
EVICQVLHLGTVTDFKQTVNKGYWFSVPLLLSIVSLVILLVLISILLYWKRHRNQDRGELSQGVQKMT      211 - 278
//

Text Mined References (79)

PMID Year Title
26763359 2015 CD200 Expression on Plasma Cell Myeloma Cells is Associated with the Efficacies of Bortezomib, Lenalidomide and Thalidomide.
26670206 2016 CD200 increases alternatively activated macrophages through cAMP-response element binding protein - C/EBP-beta signaling.
26338961 2015 Clinical impact of CD200 expression in patients with acute myeloid leukemia and correlation with other molecular prognostic factors.
26137961 2015 CD200/BTLA deletions in pediatric precursor B-cell acute lymphoblastic leukemia treated according to the EORTC-CLG 58951 protocol.
26123445 2015 The CD200 tolerance-signaling molecule and its receptor, CD200R1, are expressed in human placental villus trophoblast and in peri-implant decidua by 5 weeks' gestation.
25791119 2015 Expression patterns of CD200 and CD148 in leukemic B-cell chronic lymphoproliferative disorders and their potential value in differential diagnosis.
25778329 Proteomics pattern of peritoneal sApo-2L but not CD200 (OX-2) as a possible screening biomarker for metastatic ovarian, endometrial and breast carcinoma.
25470765 2015 Combination of CD160 and CD200 as a useful tool for differential diagnosis between chronic lymphocytic leukemia and other mature B-cell neoplasms.
25389338 2014 Differential expression of CD200 in B-cell neoplasms by flow cytometry can assist in diagnosis, subclassification, and bone marrow staging.
25261692 2015 Aberrant CD200/CD200R1 expression and its potential role in Th17 cell differentiation, chemotaxis and osteoclastogenesis in rheumatoid arthritis.
More...