Property Summary

NCBI Gene PubMed Count 95
PubMed Score 357.55
PubTator Score 194.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Disease log2 FC p
active Crohn's disease 1.075 7.0e-03
adult high grade glioma -2.100 3.0e-05
astrocytic glioma -1.800 8.0e-03
Astrocytoma, Pilocytic -1.100 2.8e-04
atypical teratoid / rhabdoid tumor -2.200 1.3e-04
Breast cancer 2.400 2.7e-02
breast carcinoma -1.100 5.5e-19
cystic fibrosis 1.161 3.8e-03
ependymoma -2.400 1.7e-02
glioblastoma -1.900 1.6e-08
intraductal papillary-mucinous adenoma (... -2.000 6.9e-03
intraductal papillary-mucinous carcinoma... -1.800 1.7e-02
lung cancer -1.100 2.1e-02
lung carcinoma 1.300 1.9e-07
malignant mesothelioma -6.000 1.7e-09
medulloblastoma, large-cell -2.600 3.7e-04
nasopharyngeal carcinoma 1.100 6.4e-03
oligodendroglioma -1.700 9.4e-03
ovarian cancer -1.100 2.7e-03
Parkinson's disease -1.200 8.7e-03
Pick disease -1.600 5.1e-03
pituitary cancer 1.200 5.0e-06
psoriasis -1.600 8.4e-05
sonic hedgehog group medulloblastoma -1.300 2.4e-02
subependymal giant cell astrocytoma -2.370 2.2e-02
tuberculosis -1.500 3.5e-03
ulcerative colitis 1.100 4.9e-04
Waldenstrons macroglobulinemia -1.912 1.9e-02

Protein-protein Interaction (1)

Gene RIF (87)

AA Sequence

MERLVIRMPFSHLSTYSLVWVMAAVVLCTAQVQVVTQDEREQLYTPASLKCSLQNAQEALIVTWQKKKAV      1 - 70
SPENMVTFSENHGVVIQPAYKDKINITQLGLQNSTITFWNITLEDEGCYMCLFNTFGFGKISGTACLTVY     71 - 140
VQPIVSLHYKFSEDHLNITCSATARPAPMVFWKVPRSGIENSTVTLSHPNGTTSVTSILHIKDPKNQVGK    141 - 210
EVICQVLHLGTVTDFKQTVNKGYWFSVPLLLSIVSLVILLVLISILLYWKRHRNQDRGELSQGVQKMT      211 - 278
//

Text Mined References (97)

PMID Year Title