Property Summary

NCBI Gene PubMed Count 9
PubMed Score 22.13
PubTator Score 3.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 1.93283272957304E-5
medulloblastoma, large-cell 6234 3.1678251630981E-4
osteosarcoma 7933 9.40809292949387E-4
primary pancreatic ductal adenocarcinoma 1271 0.00710800750385349
Disease Target Count Z-score Confidence
Actinic keratosis 22 3.236 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.497 0.001
medulloblastoma, large-cell 1.100 0.000
primary pancreatic ductal adenocarcinoma -1.051 0.007
ovarian cancer -1.400 0.000

Synonym

Accession P41214 Q5SY40 Q8IXV3 Q96DG3 Q96TG7 Q9NR27 Q9NSN0 Q9NV18 Q9NZ21 eIF2d
Symbols LGTN
HCA56

Gene

PANTHER Protein Class (1)

  Ortholog (10)

Species Source
Chimp OMA Inparanoid
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Xenopus OMA Inparanoid
S.cerevisiae OMA Inparanoid

AA Sequence

MFAKAFRVKSNTAIKGSDRRKLRADVTTAFPTLGTDQVSELVPGKEELNIVKLYAHKGDAVTVYVSGGNP      1 - 70
ILFELEKNLYPTVYTLWSYPDLLPTFTTWPLVLEKLVGGADLMLPGLVMPPAGLPQVQKGDLCAISLVGN     71 - 140
RAPVAIGVAAMSTAEMLTSGLKGRGFSVLHTYQDHLWRSGNKSSPPSIAPLALDSADLSEEKGSVQMDST    141 - 210
LQGDMRHMTLEGEEENGEVHQAREDKSLSEAPEDTSTRGLNQDSTDSKTLQEQMDELLQQCFLHALKCRV    211 - 280
KKADLPLLTSTFLGSHMFSCCPEGRQLDIKKSSYKKLSKFLQQMQQEQIIQVKELSKGVESIVAVDWKHP    281 - 350
RITSFVIPEPSPTSQTIQEGSREQPYHPPDIKPLYCVPASMTLLFQESGHKKGSFLEGSEVRTIVINYAK    351 - 420
KNDLVDADNKNLVRLDPILCDCILEKNEQHTVMKLPWDSLLTRCLEKLQPAYQVTLPGQEPIVKKGRICP    421 - 490
IDITLAQRASNKKVTVVRNLEAYGLDPYSVAAILQQRCQASTTVNPAPGAKDSLQVQIQGNQVHHLGWLL    491 - 560
LEEYQLPRKHIQGLEKALKPGKKK                                                  561 - 584
//

Text Mined References (19)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
20713520 2010 Activities of Ligatin and MCT-1/DENR in eukaryotic translation initiation and ribosomal recycling.
20566627 2010 GTP-independent tRNA delivery to the ribosomal P-site by a novel eukaryotic translation factor.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
More...