Property Summary

NCBI Gene PubMed Count 10
PubMed Score 24.28
PubTator Score 3.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Actinic keratosis 21 3.105 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
medulloblastoma, large-cell 1.100 3.2e-04
osteosarcoma -1.497 9.4e-04
ovarian cancer -1.400 1.9e-05
primary pancreatic ductal adenocarcinoma -1.051 7.1e-03

Gene RIF (1)

AA Sequence

MFAKAFRVKSNTAIKGSDRRKLRADVTTAFPTLGTDQVSELVPGKEELNIVKLYAHKGDAVTVYVSGGNP      1 - 70
ILFELEKNLYPTVYTLWSYPDLLPTFTTWPLVLEKLVGGADLMLPGLVMPPAGLPQVQKGDLCAISLVGN     71 - 140
RAPVAIGVAAMSTAEMLTSGLKGRGFSVLHTYQDHLWRSGNKSSPPSIAPLALDSADLSEEKGSVQMDST    141 - 210
LQGDMRHMTLEGEEENGEVHQAREDKSLSEAPEDTSTRGLNQDSTDSKTLQEQMDELLQQCFLHALKCRV    211 - 280
KKADLPLLTSTFLGSHMFSCCPEGRQLDIKKSSYKKLSKFLQQMQQEQIIQVKELSKGVESIVAVDWKHP    281 - 350
RITSFVIPEPSPTSQTIQEGSREQPYHPPDIKPLYCVPASMTLLFQESGHKKGSFLEGSEVRTIVINYAK    351 - 420
KNDLVDADNKNLVRLDPILCDCILEKNEQHTVMKLPWDSLLTRCLEKLQPAYQVTLPGQEPIVKKGRICP    421 - 490
IDITLAQRASNKKVTVVRNLEAYGLDPYSVAAILQQRCQASTTVNPAPGAKDSLQVQIQGNQVHHLGWLL    491 - 560
LEEYQLPRKHIQGLEKALKPGKKK                                                  561 - 584
//

Text Mined References (20)

PMID Year Title