Property Summary

NCBI Gene PubMed Count 220
PubMed Score 455.74
PubTator Score 1445.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Kidney cancer 2613 0.0 0.7
Disease Target Count Z-score Confidence
Acquired metabolic disease 336 0.0 3.0
Parkinson's disease 392 0.0 0.8
Disease Target Count Z-score Confidence
Cancer 2499 5.388 2.7
Disease Target Count Z-score Confidence
Hypereosinophilic syndrome 71 3.554 1.8

Expression

  Differential Expression (13)

Disease log2 FC p
Astrocytoma, Pilocytic 1.600 5.0e-07
Breast cancer -1.200 4.6e-11
ependymoma 1.100 8.6e-06
glioblastoma 1.300 1.2e-05
group 4 medulloblastoma -1.600 5.1e-04
intraductal papillary-mucinous neoplasm ... 1.200 5.0e-03
medulloblastoma, large-cell -1.500 1.1e-02
osteosarcoma -1.211 1.8e-03
ovarian cancer 1.900 7.6e-06
pediatric high grade glioma 1.400 6.4e-05
psoriasis -1.300 5.6e-03
subependymal giant cell astrocytoma 1.227 3.8e-03
tuberculosis -1.800 6.9e-09

Protein-protein Interaction (3)

Gene RIF (182)

AA Sequence

MSETPAQCSIKQERISYTPPESPVPSYASSTPLHVPVPRALRMEEDSIRLPAHLRLQPIYWSRDDVAQWL      1 - 70
KWAENEFSLRPIDSNTFEMNGKALLLLTKEDFRYRSPHSGDVLYELLQHILKQRKPRILFSPFFHPGNSI     71 - 140
HTQPEVILHQNHEEDNCVQRTPRPSVDNVHHNPPTIELLHRSRSPITTNHRPSPDPEQRPLRSPLDNMIR    141 - 210
RLSPAERAQGPRPHQENNHQESYPLSVSPMENNHCPASSESHPKPSSPRQESTRVIQLMPSPIMHPLILN    211 - 280
PRHSVDFKQSRLSEDGLHREGKPINLSHREDLAYMNHIMVSVSPPEEHAMPIGRIADCRLLWDYVYQLLS    281 - 350
DSRYENFIRWEDKESKIFRIVDPNGLARLWGNHKNRTNMTYEKMSRALRHYYKLNIIRKEPGQRLLFRFM    351 - 420
KTPDEIMSGRTDRLEHLESQELDEQIYQEDEC                                          421 - 452
//

Text Mined References (234)

PMID Year Title