Property Summary

NCBI Gene PubMed Count 198
Grant Count 60
R01 Count 35
Funding $8,223,558.97
PubMed Score 420.52
PubTator Score 1445.26

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P41212 A3QVP6 A8K076 Q9UMF6 Q9UMF7 Q9UMG0
Symbols TEL
THC5
TEL/ABL

Gene

PANTHER Protein Class (1)

PDB

1JI7   1LKY   2DAO   2QAR   2QB0   2QB1  

Gene RIF (160)

PMID Text
26852652 ETV6/RUNX1 transcript is a target of RNA-binding protein IGF2BP1 in t(12;21)(p13;q22)-positive acute lymphoblastic leukemia.
26625756 The study shows a low representation of ETV6-RUNX1 fusion oncogenes among pediatric acute lymphoblastic leukemia patients from King Abdulaziz Medical City, National Guard Health Affairs, Riyadh, Saudi Arabia.
26606880 the ETV6-NTRK3 fusion might identify a subset of gastrointestinal stromal tumours with peculiar clinicopathological characteristics
26580398 our results demonstrate that MIR181A1 and ETV6/RUNX1 regulate each other, and we propose that a double negative loop involving MIR181A1 and ETV6/RUNX1 may contribute to ETV6/RUNX1-driven arrest of differentiation in pre-B ALL.
26522332 Suggest germline ETV6 variations as the basis of a novel genetic syndrome associated with predisposition to childhood acute lymphoblastic leukemia.
26492182 Molecular analysis of ETV6 gene rearranged mammary analogue secretory carcinoma of salivary glands tumors with lack of classical ETV6-NTRK3 fusion.
26291510 Spectrum of secretory breast carcinoma with ETV6-NTRK3 gene fusion ranging from low-grade to high-grade histology, with occasional low hormonal receptor expression, simplex genomic profiles, and possible unfavorable course.
26237075 We observed significant enrichment of the neuroactive ligand-receptor interaction pathway in TCF3-PBX1 as well as an enrichment of genes involved in immunity and infection pathways in ETV6-RUNX1 subtype
26102509 germline ETV6 mutations associated with leukemia and thrombocytopenia were identifies in multiple individuals. Mutant ETV6 showed decreased ability to regulate expression of other genes.
26045802 Our study demonstrated that ETV6 was markedly involved in the development of non-small cell lung cancer and could serve as a potential prognostic marker for this deadly disease
More...

AA Sequence

MSETPAQCSIKQERISYTPPESPVPSYASSTPLHVPVPRALRMEEDSIRLPAHLRLQPIYWSRDDVAQWL      1 - 70
KWAENEFSLRPIDSNTFEMNGKALLLLTKEDFRYRSPHSGDVLYELLQHILKQRKPRILFSPFFHPGNSI     71 - 140
HTQPEVILHQNHEEDNCVQRTPRPSVDNVHHNPPTIELLHRSRSPITTNHRPSPDPEQRPLRSPLDNMIR    141 - 210
RLSPAERAQGPRPHQENNHQESYPLSVSPMENNHCPASSESHPKPSSPRQESTRVIQLMPSPIMHPLILN    211 - 280
PRHSVDFKQSRLSEDGLHREGKPINLSHREDLAYMNHIMVSVSPPEEHAMPIGRIADCRLLWDYVYQLLS    281 - 350
DSRYENFIRWEDKESKIFRIVDPNGLARLWGNHKNRTNMTYEKMSRALRHYYKLNIIRKEPGQRLLFRFM    351 - 420
KTPDEIMSGRTDRLEHLESQELDEQIYQEDEC                                          421 - 452
//

Text Mined References (211)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26852652 2016 ETV6/RUNX1 transcript is a target of RNA-binding protein IGF2BP1 in t(12;21)(p13;q22)-positive acute lymphoblastic leukemia.
26625756 2015 Low Frequency of ETV6-RUNX1 (t 12; 21) in Saudi Arabian Pediatric Acute Lymphoblastic Leukemia Patients: Association with Clinical Parameters and Early Remission.
26606880 2016 Transcriptome sequencing identifies ETV6-NTRK3 as a gene fusion involved in GIST.
26580398 2015 A Double Negative Loop Comprising ETV6/RUNX1 and MIR181A1 Contributes to Differentiation Block in t(12;21)-Positive Acute Lymphoblastic Leukemia.
26522332 2015 Germline genetic variation in ETV6 and risk of childhood acute lymphoblastic leukaemia: a systematic genetic study.
26492182 2016 Mammary Analogue Secretory Carcinoma of Salivary Glands: Molecular Analysis of 25 ETV6 Gene Rearranged Tumors With Lack of Detection of Classical ETV6-NTRK3 Fusion Transcript by Standard RT-PCR: Report of 4 Cases Harboring ETV6-X Gene Fusion.
26291510 2015 Secretory Breast Carcinoma: A Histopathologic and Genomic Spectrum Characterized by a Joint Specific ETV6-NTRK3 Gene Fusion.
26237075 2015 Epigenetic landscape correlates with genetic subtype but does not predict outcome in childhood acute lymphoblastic leukemia.
26102509 2015 Germline ETV6 Mutations Confer Susceptibility to Acute Lymphoblastic Leukemia and Thrombocytopenia.
More...