Property Summary

NCBI Gene PubMed Count 59
PubMed Score 88.08
PubTator Score 65.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (7)

Disease log2 FC p
Breast cancer 3.400 2.8e-02
chronic rhinosinusitis -1.712 3.7e-02
dermatomyositis 1.100 1.1e-03
ependymoma 1.900 8.9e-15
medulloblastoma, large-cell -1.300 1.0e-03
nasopharyngeal carcinoma -1.200 8.4e-04
ovarian cancer -1.400 1.2e-04

Protein-protein Interaction (1)

Gene RIF (30)

AA Sequence

MASNFKKANMASSSQRKRMSPKPELTEEQKQEIREAFDLFDADGTGTIDVKELKVAMRALGFEPKKEEIK      1 - 70
KMISEIDKEGTGKMNFGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDE     71 - 140
ELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY                                          141 - 172
//

Text Mined References (71)

PMID Year Title