Property Summary

NCBI Gene PubMed Count 58
PubMed Score 82.37
PubTator Score 65.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 3.30156384343457E-17
nasopharyngeal carcinoma 1056 8.44073653171341E-4
ovarian cancer 8492 0.00101826714655698
medulloblastoma, large-cell 6234 0.00104316307032011
dermatomyositis 967 0.00107143149776256
Breast cancer 3099 0.0283300008025953
chronic rhinosinusitis 512 0.0372840698555968
Disease Target Count Z-score Confidence
Xeroderma pigmentosum 41 4.794 2.4
Ciliopathy 57 3.547 1.8

Expression

  Differential Expression (7)

Disease log2 FC p
posterior fossa group B ependymoma 2.400 0.000
medulloblastoma, large-cell -1.300 0.001
Breast cancer 3.400 0.028
nasopharyngeal carcinoma -1.200 0.001
ovarian cancer 1.800 0.001
chronic rhinosinusitis -1.712 0.037
dermatomyositis 1.100 0.001

Synonym

Accession P41208 B2R4T4 Q53XW1
Symbols CALT
CEN2

Gene

PDB

2A4J   2GGM   2OBH   2K2I   1M39   1ZMZ  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG
Opossum OMA Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG Inparanoid

 GO Function (1)

Gene RIF (29)

PMID Text
26354417 Cetn3 inhibits Mps1 autophosphorylation at Thr-676, a known site of T-loop autoactivation, and interferes with Mps1-dependent phosphorylation of Cetn2. The cellular overexpression of Cetn3 attenuates the incorporation of Cetn2 into centrioles and centrosome reduplication, whereas depletion of Cetn3 generates extra centrioles.
25753040 Centrin2 regulates primary ciliogenesis through controlling CP110 levels.
24291146 co-depletion of centrin 2 and PCID2 leads to blocking rather than delaying nuclear protein export, indicating the dominance of the centrin 2 phenotype.
23844208 Data indicate that overexpression of the centrin interactor POC5 leads to the assembly of linear, centrin-dependent structures.
23840880 CDC25B, through activation of a centrosomal pool of CDK2, stabilises the local pool of Mps1 which in turn regulates the level of centrin 2 at the centrosome.
22809153 Cen2 influences the binding of RPA and XPA with damaged DNA.
21731694 The stability of centrin is regulated in part by Aurora A.
21676658 xeroderma pigmentosum complementation group C expression correlates with a decreased amount of CENTRIN 2 transcript and protein
21091437 CDC25B forms a close association with Ctn-2 proteins at the centrosome.
20980622 Mps1-dependent phosphorylation of Cetn2 stimulates the canonical centriole assembly pathway.
More...

AA Sequence

MASNFKKANMASSSQRKRMSPKPELTEEQKQEIREAFDLFDADGTGTIDVKELKVAMRALGFEPKKEEIK      1 - 70
KMISEIDKEGTGKMNFGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDE     71 - 140
ELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY                                          141 - 172
//

Text Mined References (69)

PMID Year Title
26638075 2015 A Dynamic Protein Interaction Landscape of the Human Centrosome-Cilium Interface.
26354417 2015 Centrin 3 is an inhibitor of centrosomal Mps1 and antagonizes centrin 2 function.
25753040 2015 Centrin2 regulates CP110 removal in primary cilium formation.
25416956 2014 A proteome-scale map of the human interactome network.
24421332 2014 The CP110-interacting proteins Talpid3 and Cep290 play overlapping and distinct roles in cilia assembly.
24291146 2014 Human TREX2 components PCID2 and centrin 2, but not ENY2, have distinct functions in protein export and co-localize to the centrosome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23844208 2013 Calcium-binding capacity of centrin2 is required for linear POC5 assembly but not for nucleotide excision repair.
23840880 2013 CDC25B overexpression stabilises centrin 2 and promotes the formation of excess centriolar foci.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...