Property Summary

NCBI Gene PubMed Count 58
Grant Count 19
R01 Count 7
Funding $523,292.06
PubMed Score 82.37
PubTator Score 65.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
posterior fossa group B ependymoma 2.400 0.000
medulloblastoma, large-cell -1.300 0.001
Breast cancer 3.400 0.028
nasopharyngeal carcinoma -1.200 0.001
ovarian cancer 1.800 0.001
chronic rhinosinusitis -1.712 0.037
dermatomyositis 1.100 0.001

 GO Function (1)

Gene RIF (29)

PMID Text
26354417 Cetn3 inhibits Mps1 autophosphorylation at Thr-676, a known site of T-loop autoactivation, and interferes with Mps1-dependent phosphorylation of Cetn2. The cellular overexpression of Cetn3 attenuates the incorporation of Cetn2 into centrioles and centrosome reduplication, whereas depletion of Cetn3 generates extra centrioles.
25753040 Centrin2 regulates primary ciliogenesis through controlling CP110 levels.
24291146 co-depletion of centrin 2 and PCID2 leads to blocking rather than delaying nuclear protein export, indicating the dominance of the centrin 2 phenotype.
23844208 Data indicate that overexpression of the centrin interactor POC5 leads to the assembly of linear, centrin-dependent structures.
23840880 CDC25B, through activation of a centrosomal pool of CDK2, stabilises the local pool of Mps1 which in turn regulates the level of centrin 2 at the centrosome.
22809153 Cen2 influences the binding of RPA and XPA with damaged DNA.
21731694 The stability of centrin is regulated in part by Aurora A.
21676658 xeroderma pigmentosum complementation group C expression correlates with a decreased amount of CENTRIN 2 transcript and protein
21091437 CDC25B forms a close association with Ctn-2 proteins at the centrosome.
20980622 Mps1-dependent phosphorylation of Cetn2 stimulates the canonical centriole assembly pathway.
More...

AA Sequence

MASNFKKANMASSSQRKRMSPKPELTEEQKQEIREAFDLFDADGTGTIDVKELKVAMRALGFEPKKEEIK      1 - 70
KMISEIDKEGTGKMNFGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDE     71 - 140
ELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY                                          141 - 172
//

Text Mined References (69)

PMID Year Title
26638075 2015 A Dynamic Protein Interaction Landscape of the Human Centrosome-Cilium Interface.
26354417 2015 Centrin 3 is an inhibitor of centrosomal Mps1 and antagonizes centrin 2 function.
25753040 2015 Centrin2 regulates CP110 removal in primary cilium formation.
25416956 2014 A proteome-scale map of the human interactome network.
24421332 2014 The CP110-interacting proteins Talpid3 and Cep290 play overlapping and distinct roles in cilia assembly.
24291146 2014 Human TREX2 components PCID2 and centrin 2, but not ENY2, have distinct functions in protein export and co-localize to the centrosome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23844208 2013 Calcium-binding capacity of centrin2 is required for linear POC5 assembly but not for nucleotide excision repair.
23840880 2013 CDC25B overexpression stabilises centrin 2 and promotes the formation of excess centriolar foci.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...