Property Summary

NCBI Gene PubMed Count 271
PubMed Score 987.85
PubTator Score 806.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Disease Target Count P-value
lung carcinoma 2844 2.77238232065693E-15
ulcerative colitis 2087 4.32307978035674E-7
group 4 medulloblastoma 1875 6.00190028874118E-7
malignant mesothelioma 3163 1.51554051623983E-6
pituitary cancer 1972 3.08239769378632E-6
breast carcinoma 1614 3.85992116616622E-6
lung cancer 4473 6.16314892133946E-6
medulloblastoma, large-cell 6234 4.01316549554298E-5
atypical teratoid/rhabdoid tumor 1095 5.05331913434678E-5
osteosarcoma 7933 9.87884211297074E-5
ovarian cancer 8492 1.04760181876724E-4
invasive ductal carcinoma 2950 1.04995397592415E-4
psoriasis 6685 1.73311664529326E-4
astrocytoma 1493 1.77687275761301E-4
ductal carcinoma in situ 1745 2.18218127271824E-4
axial spondyloarthropathy 28 8.99082512822229E-4
dermatomyositis 967 0.00113952551108828
glioblastoma 5572 0.00137017204233249
oligodendroglioma 2849 0.00259647644666955
gastric carcinoma 832 0.00352093510287558
subependymal giant cell astrocytoma 2287 0.00502222067150738
ependymoma 2514 0.00548576373169827
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00926098914140822
mucosa-associated lymphoid tissue lymphoma 480 0.012437255339652
aldosterone-producing adenoma 664 0.0128458679582413
pancreatic cancer 2300 0.0155565470289652
primitive neuroectodermal tumor 3031 0.015938539929825
Pick disease 1893 0.030542480140562
primary pancreatic ductal adenocarcinoma 1271 0.0323675397507967
active Crohn's disease 918 0.0336132604386615
Rheumatoid Arthritis 1171 0.0355106456733488
Hydrolethalus syndrome 128 0.0491523828186899
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Cancer 2346 0.0 4.0
Disease Target Count
Lymphoma, T-Cell 3
follicular lymphoma 17

Expression

  Differential Expression (32)

Synonym

Accession P41182 A7E241 B8PSA7 D3DNV5 BCL-6
Symbols BCL5
LAZ3
BCL6A
ZNF51
ZBTB27

Gene

PDB

1R2B   3BIM   1R28   1R29   2EN2   2EOS   2LCE   2YRM   3E4U   3LBZ   4CP3   4U2M  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

 GO Component (2)

 GWAS Trait (1)

Gene RIF (228)

PMID Text
26945968 These results suggest that STAT6 plays an important role in regulating Sp1 and BCL6 through STAT2 to exert the anti-proliferative effects of type I IFN.
26845350 Taken together, our results demonstrated that miR-187-3p played a pivotal role on NSCLC through inhibiting cell proliferation, migration, invasion, and promoting apoptosis by targeting oncogenic BCL6.
26590574 Identified BCL6 to be a target of miR-10a in patients with Acute Myeloid Leukemia (AML).
26566802 Studies indicate that germinal centers (GC) B cells represent the normal counterpart of most B-cell lymphomas, which are often characterized by deregulated B cell lymphoma 6 (BCL6) expression or BCL6-mediated pathways.
26565895 Non-Hodgkin lymphomas with MYC+/BCL2+/BCL6- gene rearrangements was more likely to have a non-germinal center cell of origin than MYC+/BCL2-/BCL6+ and MYC+/BCL2+/BCL6+ lymphomas.
26448193 High-grade B-cell lymphoma with MYC rearrangement and without BCL2/BCL6 rearrangements is associated with high P53 expression and a poor prognosis.
26414904 BCL6 gene expression is plays a role in the pathogenesis of diffuse large B-cell lymphoma.
26343374 Study demonstrates that survivin belongs to the Tfh cell phenotype and ensures their optimal function by regulating transcriptional activity of Bcl-6.
26276666 we found that the boundaries of lnc-RP11-211G3.3.1-1 match the boundaries of the BCL6 translocation zone quite precisely
26214636 Patients with BCL2+ and BCL6- diffuse large B cell lymphoma patients benefit from R-CHOP therapy.
More...

AA Sequence

MASPADSCIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLFYSIFTDQLKCNLS      1 - 70
VINLDPEINPEGFCILLDFMYTSRLNLREGNIMAVMATAMYLQMEHVVDTCRKFIKASEAEMVSAIKPPR     71 - 140
EEFLNSRMLMPQDIMAYRGREVVENNLPLRSAPGCESRAFAPSLYSGLSTPPASYSMYSHLPVSSLLFSD    141 - 210
EEFRDVRMPVANPFPKERALPCDSARPVPGEYSRPTLEVSPNVCHSNIYSPKETIPEEARSDMHYSVAEG    211 - 280
LKPAAPSARNAPYFPCDKASKEEERPSSEDEIALHFEPPNAPLNRKGLVSPQSPQKSDCQPNSPTESCSS    281 - 350
KNACILQASGSPPAKSPTDPKACNWKKYKFIVLNSLNQNAKPEGPEQAELGRLSPRAYTAPPACQPPMEP    351 - 420
ENLDLQSPTKLSASGEDSTIPQASRLNNIVNRSMTGSPRSSSESHSPLYMHPPKCTSCGSQSPQHAEMCL    421 - 490
HTAGPTFPEEMGETQSEYSDSSCENGAFFCNECDCRFSEEASLKRHTLQTHSDKPYKCDRCQASFRYKGN    491 - 560
LASHKTVHTGEKPYRCNICGAQFNRPANLKTHTRIHSGEKPYKCETCGARFVQVAHLRAHVLIHTGEKPY    561 - 630
PCEICGTRFRHLQTLKSHLRIHTGEKPYHCEKCNLHFRHKSQLRLHLRQKHGAITNTKVQYRVSATDLPP    631 - 700
ELPKAC                                                                    701 - 706
//

Text Mined References (283)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26945968 2016 The anti-proliferative effects of type I IFN involve STAT6-mediated regulation of SP1 and BCL6.
26845350 2016 MicroRNA-187-3p mitigates non-small cell lung cancer (NSCLC) development through down-regulation of BCL6.
26590574 2016 CD4+ T cells from patients with acute myeloid leukemia inhibit the proliferation of bone marrow-derived mesenchymal stem cells by secretion of miR-10a.
26566802 2015 Mechanisms of action of BCL6 during germinal center B cell development.
26565895 2016 Impact of oncogene rearrangement patterns on outcomes in patients with double-hit non-Hodgkin lymphoma.
26448193 2016 High-grade B-cell Lymphoma With MYC Rearrangement and Without BCL2 and BCL6 Rearrangements Is Associated With High P53 Expression and a Poor Prognosis.
26414904 2016 CD10, BCL6, and MUM1 expression in diffuse large B-cell lymphoma on FNA samples.
26343374 2015 Survivin co-ordinates formation of follicular T-cells acting in synergy with Bcl-6.
26276666 2015 Convergent BCL6 and lncRNA promoters demarcate the major breakpoint region for BCL6 translocations.
More...