Property Summary

NCBI Gene PubMed Count 299
PubMed Score 1049.91
PubTator Score 806.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Lymphoma, Non-Hodgkin 24 0.0 0.0
Lymphoma, T-Cell 13 0.0 0.0
Disease Target Count Z-score Confidence
Cancer 2499 0.0 4.0
Disease Target Count
follicular lymphoma 20

Expression

  Differential Expression (32)

Disease log2 FC p
active Crohn's disease 1.414 3.4e-02
active ulcerative colitis 1.286 2.6e-02
aldosterone-producing adenoma -1.208 1.3e-02
astrocytic glioma 1.400 4.9e-02
atypical teratoid / rhabdoid tumor -1.400 1.3e-03
axial spondyloarthropathy 1.700 9.0e-04
breast carcinoma -1.600 3.9e-06
dermatomyositis 1.100 1.1e-03
ductal carcinoma in situ -1.100 1.5e-03
ependymoma 1.800 3.1e-02
gastric carcinoma 1.400 3.5e-03
glioblastoma 1.700 1.4e-03
group 3 medulloblastoma -2.100 6.7e-04
Hydrolethalus syndrome 1.009 4.9e-02
intraductal papillary-mucinous adenoma (... -1.200 9.3e-03
invasive ductal carcinoma -1.400 9.1e-04
lung cancer -1.300 2.6e-03
lung carcinoma -1.100 2.8e-15
malignant mesothelioma -1.200 3.2e-06
medulloblastoma, large-cell -3.400 4.0e-05
mucosa-associated lymphoid tissue lympho... 1.220 1.2e-02
oligodendroglioma 1.200 4.2e-02
osteosarcoma -2.219 9.9e-05
ovarian cancer -1.200 4.2e-03
pancreatic cancer 1.100 1.6e-02
Pick disease 1.100 3.1e-02
pituitary cancer -1.300 1.1e-02
primary pancreatic ductal adenocarcinoma 1.107 3.2e-02
primitive neuroectodermal tumor -1.200 1.6e-02
psoriasis -1.500 1.7e-04
Rheumatoid arthritis 1.300 3.6e-02
subependymal giant cell astrocytoma -1.588 5.0e-03

Protein-protein Interaction (1)

Gene RIF (253)

AA Sequence

MASPADSCIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLFYSIFTDQLKCNLS      1 - 70
VINLDPEINPEGFCILLDFMYTSRLNLREGNIMAVMATAMYLQMEHVVDTCRKFIKASEAEMVSAIKPPR     71 - 140
EEFLNSRMLMPQDIMAYRGREVVENNLPLRSAPGCESRAFAPSLYSGLSTPPASYSMYSHLPVSSLLFSD    141 - 210
EEFRDVRMPVANPFPKERALPCDSARPVPGEYSRPTLEVSPNVCHSNIYSPKETIPEEARSDMHYSVAEG    211 - 280
LKPAAPSARNAPYFPCDKASKEEERPSSEDEIALHFEPPNAPLNRKGLVSPQSPQKSDCQPNSPTESCSS    281 - 350
KNACILQASGSPPAKSPTDPKACNWKKYKFIVLNSLNQNAKPEGPEQAELGRLSPRAYTAPPACQPPMEP    351 - 420
ENLDLQSPTKLSASGEDSTIPQASRLNNIVNRSMTGSPRSSSESHSPLYMHPPKCTSCGSQSPQHAEMCL    421 - 490
HTAGPTFPEEMGETQSEYSDSSCENGAFFCNECDCRFSEEASLKRHTLQTHSDKPYKCDRCQASFRYKGN    491 - 560
LASHKTVHTGEKPYRCNICGAQFNRPANLKTHTRIHSGEKPYKCETCGARFVQVAHLRAHVLIHTGEKPY    561 - 630
PCEICGTRFRHLQTLKSHLRIHTGEKPYHCEKCNLHFRHKSQLRLHLRQKHGAITNTKVQYRVSATDLPP    631 - 700
ELPKAC                                                                    701 - 706
//

Text Mined References (311)

PMID Year Title