Property Summary

NCBI Gene PubMed Count 158
PubMed Score 957.66
PubTator Score 453.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Cardiomyopathies 110 0.0 0.0
Diabetes Insipidus, Nephrogenic 3 0.0 0.0
Disease Target Count P-value
psoriasis 6694 3.4e-09
osteosarcoma 7950 2.4e-08
aldosterone-producing adenoma 665 2.7e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Diabetes insipidus 18 0.0 4.0

Expression

  Differential Expression (3)

Disease log2 FC p
aldosterone-producing adenoma 1.051 2.7e-02
osteosarcoma 1.646 2.4e-08
psoriasis -1.300 3.4e-09

Gene RIF (100)

AA Sequence

MWELRSIAFSRAVFAEFLATLLFVFFGLGSALNWPQALPSVLQIAMAFGLGIGTLVQALGHISGAHINPA      1 - 70
VTVACLVGCHVSVLRAAFYVAAQLLGAVAGAALLHEITPADIRGDLAVNALSNSTTAGQAVTVELFLTLQ     71 - 140
LVLCIFASTDERRGENPGTPALSIGFSVALGHLLGIHYTGCSMNPARSLAPAVVTGKFDDHWVFWIGPLV    141 - 210
GAILGSLLYNYVLFPPAKSLSERLAVLKGLEPDTDWEEREVRRRQSVELHSPQSLPRGTKA             211 - 271
//

Text Mined References (162)

PMID Year Title