Property Summary

Ligand Count 95
NCBI Gene PubMed Count 412
PubMed Score 1714.87
PubTator Score 875.21

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count
Calcinosis 70
Hypophosphatemia 40
Basal ganglia calcification 27
Abdominal Pain 98
Abnormal renal function 3
Abnormal respiratory patterns 20
Abnormal urinary amino-acid findings 38
Abnormality of calcium-phosphate metabolism 4
Abnormality of the fingernails 51
Abnormality of the metaphyses 48
Alopecia 115
Aminoaciduria 38
Anemia 365
Anxiety 136
Anxiety disease 113
Cardiac Arrhythmia 103
Cardiac conduction abnormalities 78
Cerebral cortex myoclonus 3
Conduction disorder of the heart 79
Constipation 181
Depressive disorder 409
Dry skin 75
Dyschezia 135
Dyspnea 76
EKG abnormalities 78
EPILEPSY, IDIOPATHIC GENERALIZED, SUSCEPTIBILITY TO, 8 1
Electrocardiogram abnormal 81
Electrocardiogram change 78
Electromyogram abnormal 49
Epilepsy 792
Failure to gain weight 365
Familial benign hypercalcemia 1
Feeding difficulties in infancy 175
Frequent fractures 53
HYPERPARATHYROIDISM, NEONATAL SEVERE 1
Hemoglobin low 124
Hepatomegaly 285
Hypercalciuria 27
Hypermagnesemia 2
Hypermagnesiuria 3
Hyperparathyroidism, Primary 3
Hyperphosphatemia (disorder) 17
Hyperphosphaturia 21
Hypocalciuria 4
Hypomagnesemia 12
Hypotension 82
Idiopathic generalized epilepsy 14
Increased calcium level in kidney 21
Increased fracture rate 53
Increased serum parathyroid hormone 14
Metaphyseal irregularity 23
Mood swings 77
Muscle Cramp 55
Muscle hypotonia 571
Myasthenias 8
Narrow thorax 53
Nephrocalcinosis 35
Nephrolithiasis 56
Organic writer's cramp 10
Pancreatitis 123
Paresthesia 32
Pediatric failure to thrive 365
Polydipsia 15
Polyuria 23
SERUM PHOSPHATE ELEVATED 14
Seizures 596
Short stature 531
Splenomegaly 190
Tachypnea 20
Tetany 18
Thyroid Diseases 24
Urine phosphorous concentration above normal 21
Varying degree of multiple fractures 53
Xerosis 75
Disease Target Count P-value
lung carcinoma 2843 2.3e-08
osteosarcoma 7950 6.9e-08
psoriasis 6694 1.6e-03
non primary Sjogren syndrome sicca 891 1.5e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.2
Kidney cancer 2613 0.0 0.6
Melanoma 711 0.0 0.5
Skin cancer 469 0.0 0.6
Disease Target Count Z-score Confidence
Cardiovascular system disease 246 0.0 3.0
Type 2 diabetes mellitus 272 0.0 1.0

Expression

  Differential Expression (4)

Disease log2 FC p
lung carcinoma 1.500 2.3e-08
non primary Sjogren syndrome sicca 1.100 1.5e-02
osteosarcoma 1.609 6.9e-08
psoriasis 1.200 1.6e-03

Gene RIF (397)

AA Sequence

MAFYSCCWVLLALTWHTSAYGPDQRAQKKGDIILGGLFPIHFGVAAKDQDLKSRPESVECIRYNFRGFRW      1 - 70
LQAMIFAIEEINSSPALLPNLTLGYRIFDTCNTVSKALEATLSFVAQNKIDSLNLDEFCNCSEHIPSTIA     71 - 140
VVGATGSGVSTAVANLLGLFYIPQVSYASSSRLLSNKNQFKSFLRTIPNDEHQATAMADIIEYFRWNWVG    141 - 210
TIAADDDYGRPGIEKFREEAEERDICIDFSELISQYSDEEEIQHVVEVIQNSTAKVIVVFSSGPDLEPLI    211 - 280
KEIVRRNITGKIWLASEAWASSSLIAMPQYFHVVGGTIGFALKAGQIPGFREFLKKVHPRKSVHNGFAKE    281 - 350
FWEETFNCHLQEGAKGPLPVDTFLRGHEESGDRFSNSSTAFRPLCTGDENISSVETPYIDYTHLRISYNV    351 - 420
YLAVYSIAHALQDIYTCLPGRGLFTNGSCADIKKVEAWQVLKHLRHLNFTNNMGEQVTFDECGDLVGNYS    421 - 490
IINWHLSPEDGSIVFKEVGYYNVYAKKGERLFINEEKILWSGFSREVPFSNCSRDCLAGTRKGIIEGEPT    491 - 560
CCFECVECPDGEYSDETDASACNKCPDDFWSNENHTSCIAKEIEFLSWTEPFGIALTLFAVLGIFLTAFV    561 - 630
LGVFIKFRNTPIVKATNRELSYLLLFSLLCCFSSSLFFIGEPQDWTCRLRQPAFGISFVLCISCILVKTN    631 - 700
RVLLVFEAKIPTSFHRKWWGLNLQFLLVFLCTFMQIVICVIWLYTAPPSSYRNQELEDEIIFITCHEGSL    701 - 770
MALGFLIGYTCLLAAICFFFAFKSRKLPENFNEAKFITFSMLIFFIVWISFIPAYASTYGKFVSAVEVIA    771 - 840
ILAASFGLLACIFFNKIYIILFKPSRNTIEEVRCSTAAHAFKVAARATLRRSNVSRKRSSSLGGSTGSTP    841 - 910
SSSISSKSNSEDPFPQPERQKQQQPLALTQQEQQQQPLTLPQQQRSQQQPRCKQKVIFGSGTVTFSLSFD    911 - 980
EPQKNAMAHRNSTHQNSLEAQKSSDTLTRHEPLLPLQCGETDLDLTVQETGLQGPVGGDQRPEVEDPEEL    981 - 1050
SPALVVSSSQSFVISGGGSTVTENVVNS                                             1051 - 1078
//

Text Mined References (433)

PMID Year Title