Property Summary

NCBI Gene PubMed Count 369
Grant Count 444
R01 Count 187
Funding $131,192,993.2
PubMed Score 1666.16
PubTator Score 875.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis 1.200 0.002
osteosarcoma 1.609 0.000
non primary Sjogren syndrome sicca 1.100 0.015
lung carcinoma 1.500 0.000

Synonym

Accession P41180 Q13912 Q16108 Q16109 Q16110 Q16379 Q2M1T0 Q4PJ19 CaSR
Symbols CAR
FHH
FIH
HHC
EIG8
HHC1
NSHPT
PCAR1
GPRC2A
HYPOC1

Gene

PDB

5FBH   5FBK   5K5S   5K5T  

  TechDev Info (1)

Gene RIF (364)

PMID Text
27050483 CaSR-induced constitutive macropinocytosis facilitates the sentinel function of macrophages, promoting the efficient delivery of ligands to cytosolic pattern-recognition receptors.
26994139 These findings demonstrate that CaSR-targeted compounds can rectify signaling disturbances caused by germline and somatic Galpha11 mutations, which respectively lead to calcium disorders and tumorigenesis; and that ADH2-causing Galpha11 mutations induce non-constitutive alterations in MAPK signaling.
26764418 A novel naturally occurring deletion mutation within the CASR that apparently arose de novo in the father of the Autosomal dominant hypocalcemia proband.
26665756 No association was found between multiple kidney stones and polymorphisms of genes encoding KL, VDR, CASR.
26654249 There is no association between CASR SNP rs1801725, although an association between altered calcium levels and gastrointestinal motility could not be ruled out.
26436544 Aortic smooth muscle cells under static or strained conditions were exposed to CaSR agonists, R568, and CaSR silencing and over-expression. High Ca reduced CaSR expression. Cyclic strain or R568 prevented this. CaSR silencing enhanced calcification.
26431875 the S170T mutation induces a marked increase in CaSR sensitivity to [Ca(2+)]e and imply the allosteric regulation of the CaSR by aromatic amino acids
26317416 these studies suggest that 14-3-3 binding at the carboxyl terminus provides an important buffering mechanism to increase the intracellular pool of CaSR available for signaling-evoked trafficking
26252839 Results suggest that the G allele and the homozygous GG genotype of the CaSR rs17251221 polymorphism are protective against ovarian cancer and represent low risk for it.
26166472 Letter: overrepresentation of rare CASR coding variants in young French patients with idiopathic chronic pancreatitis.
More...

AA Sequence

MAFYSCCWVLLALTWHTSAYGPDQRAQKKGDIILGGLFPIHFGVAAKDQDLKSRPESVECIRYNFRGFRW      1 - 70
LQAMIFAIEEINSSPALLPNLTLGYRIFDTCNTVSKALEATLSFVAQNKIDSLNLDEFCNCSEHIPSTIA     71 - 140
VVGATGSGVSTAVANLLGLFYIPQVSYASSSRLLSNKNQFKSFLRTIPNDEHQATAMADIIEYFRWNWVG    141 - 210
TIAADDDYGRPGIEKFREEAEERDICIDFSELISQYSDEEEIQHVVEVIQNSTAKVIVVFSSGPDLEPLI    211 - 280
KEIVRRNITGKIWLASEAWASSSLIAMPQYFHVVGGTIGFALKAGQIPGFREFLKKVHPRKSVHNGFAKE    281 - 350
FWEETFNCHLQEGAKGPLPVDTFLRGHEESGDRFSNSSTAFRPLCTGDENISSVETPYIDYTHLRISYNV    351 - 420
YLAVYSIAHALQDIYTCLPGRGLFTNGSCADIKKVEAWQVLKHLRHLNFTNNMGEQVTFDECGDLVGNYS    421 - 490
IINWHLSPEDGSIVFKEVGYYNVYAKKGERLFINEEKILWSGFSREVPFSNCSRDCLAGTRKGIIEGEPT    491 - 560
CCFECVECPDGEYSDETDASACNKCPDDFWSNENHTSCIAKEIEFLSWTEPFGIALTLFAVLGIFLTAFV    561 - 630
LGVFIKFRNTPIVKATNRELSYLLLFSLLCCFSSSLFFIGEPQDWTCRLRQPAFGISFVLCISCILVKTN    631 - 700
RVLLVFEAKIPTSFHRKWWGLNLQFLLVFLCTFMQIVICVIWLYTAPPSSYRNQELEDEIIFITCHEGSL    701 - 770
MALGFLIGYTCLLAAICFFFAFKSRKLPENFNEAKFITFSMLIFFIVWISFIPAYASTYGKFVSAVEVIA    771 - 840
ILAASFGLLACIFFNKIYIILFKPSRNTIEEVRCSTAAHAFKVAARATLRRSNVSRKRSSSLGGSTGSTP    841 - 910
SSSISSKSNSEDPFPQPERQKQQQPLALTQQEQQQQPLTLPQQQRSQQQPRCKQKVIFGSGTVTFSLSFD    911 - 980
EPQKNAMAHRNSTHQNSLEAQKSSDTLTRHQPLLPLQCGETDLDLTVQETGLQGPVGGDQRPEVEDPEEL    981 - 1050
SPALVVSSSQSFVISGGGSTVTENVVNS                                             1051 - 1078
//

Text Mined References (386)

PMID Year Title
27050483 2016 Calcium-sensing receptors signal constitutive macropinocytosis and facilitate the uptake of NOD2 ligands in macrophages.
26994139 2016 Allosteric Modulation of the Calcium-sensing Receptor Rectifies Signaling Abnormalities Associated with G-protein ?-11 Mutations Causing Hypercalcemic and Hypocalcemic Disorders.
26764418 2016 Novel calcium-sensing receptor cytoplasmic tail deletion mutation causing autosomal dominant hypocalcemia: molecular and clinical study.
26665756 [GENETIC RISK FACTORS FOR MULTIPLE KIDNEY STONE FORMATION IN THE RUSSIAN POPULATION].
26654249 2015 No association between the common calcium-sensing receptor polymorphism rs1801725 and irritable bowel syndrome.
26436544 2015 Arterial Expression of the Calcium-Sensing Receptor Is Maintained by Physiological Pulsation and Protects against Calcification.
26431875 2015 Intracellular Ca(2+) oscillations generated via the extracellular Ca(2+)-sensing receptor (CaSR) in response to extracellular Ca(2+) or L-phenylalanine: Impact of the highly conservative mutation Ser170Thr.
26317416 2015 14-3-3 Proteins Buffer Intracellular Calcium Sensing Receptors to Constrain Signaling.
26252839 2015 A genetic polymorphism (rs17251221) in the calcium-sensing receptor is associated with ovarian cancer susceptibility.
26166472 2015 Overrepresentation of Rare CASR Coding Variants in a Sample of Young French Patients With Idiopathic Chronic Pancreatitis.
More...