Property Summary

NCBI Gene PubMed Count 12
PubMed Score 1789.87
PubTator Score 82.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
diabetes mellitus -1.200 3.4e-03
acute myeloid leukemia 1.500 5.7e-03
chronic rhinosinusitis -1.001 8.2e-03
intraductal papillary-mucinous neoplasm ... 1.900 1.3e-02
lung cancer -1.100 1.3e-02
medulloblastoma, large-cell 1.300 1.4e-03
ovarian cancer 1.100 3.1e-02
pancreatic cancer 1.700 2.8e-03
primary pancreatic ductal adenocarcinoma 1.524 4.4e-03
Rheumatoid arthritis -1.100 1.9e-02
tuberculosis -1.300 1.7e-06
ulcerative colitis 1.200 1.6e-06

Gene RIF (5)

AA Sequence

MKAGCSIVEKPEGGGGYQFPDWAYKTESSPGSRQIQLWHFILELLQKEEFRHVIAWQQGEYGEFVIKDPD      1 - 70
EVARLWGRRKCKPQMNYDKLSRALRYYYNKRILHKTKGKRFTYKFNFNKLVMPNYPFINIRSSGVVPQSA     71 - 140
PPVPTASSRFHFPPLDTHSPTNDVQPGRFSASSLTASGQESSNGTDRKTELSELEDGSAADWRRGVDPVS    141 - 210
SRNAIGGGGIGHQKRKPDIMLPLFARPGMYPDPHSPFAVSPIPGRGGVLNVPISPALSLTPTIFSYSPSP    211 - 280
GLSPFTSSSCFSFNPEEMKHYLHSQACSVFNYHLSPRTFPRYPGLMVPPLQCQMHPEESTQFSIKLQPPP    281 - 350
VGRKNRERVESSEESAPVTTPTMASIPPRIKVEPASEKDPESLRQSAREKEEHTQEEGTVPSRTIEEEKG    351 - 420
TIFARPAAPPIWPSVPISTPSGEPLEVTEDSEDRPGKEPSAPEKKEDALMPPKLRLKRRWNDDPEARELS    421 - 490
KSGKFLWNGSGPQGLATAAADA                                                    491 - 512
//

Text Mined References (19)

PMID Year Title