Property Summary

NCBI Gene PubMed Count 11
Grant Count 81
R01 Count 50
Funding $26,802,069.35
PubMed Score 1687.11
PubTator Score 82.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Rheumatoid Arthritis -1.100 0.019
medulloblastoma, large-cell 1.300 0.001
primary pancreatic ductal adenocarcinoma 1.524 0.004
tuberculosis -1.300 0.000
intraductal papillary-mucinous neoplasm ... 1.900 0.013
lung cancer -1.100 0.013
diabetes mellitus -1.200 0.003
acute myeloid leukemia 1.500 0.006
ulcerative colitis 1.200 0.000
ovarian cancer 1.100 0.031
chronic rhinosinusitis -1.001 0.008
pancreatic cancer 1.700 0.003

Synonym

Accession P41162 B4E3M7 Q8TAC8 Q9BX30
Symbols PE1
METS
PE-1
bA110J1.4

Gene

PANTHER Protein Class (1)

Gene RIF (5)

PMID Text
23329352 Frequent copy number gains at 1q21 and 1q32 are associated with overexpression of the ETS transcription factors ETV3 and ELF3 in breast cancer irrespective of molecular subtypes.
18976975 Knockdown of ets variant 3 (ETV3) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18025162 The ETV3 expression was strongly induced by the STAT3 pathway regulated by IL-10 but not by STAT3 signaling activated by IL-6, which cannot activate the anti-inflammatory signaling pathway.
17525531 Differential repression of c-myc and cdc2 gene expression by ERF and PE-1/METS.
14754893 PE-1/METS is an antiproliferative Ets repressor factor induced by CREB-1/CREM-1 during macrophage differentiation

AA Sequence

MKAGCSIVEKPEGGGGYQFPDWAYKTESSPGSRQIQLWHFILELLQKEEFRHVIAWQQGEYGEFVIKDPD      1 - 70
EVARLWGRRKCKPQMNYDKLSRALRYYYNKRILHKTKGKRFTYKFNFNKLVMPNYPFINIRSSGVVPQSA     71 - 140
PPVPTASSRFHFPPLDTHSPTNDVQPGRFSASSLTASGQESSNGTDRKTELSELEDGSAADWRRGVDPVS    141 - 210
SRNAIGGGGIGHQKRKPDIMLPLFARPGMYPDPHSPFAVSPIPGRGGVLNVPISPALSLTPTIFSYSPSP    211 - 280
GLSPFTSSSCFSFNPEEMKHYLHSQACSVFNYHLSPRTFPRYPGLMVPPLQCQMHPEESTQFSIKLQPPP    281 - 350
VGRKNRERVESSEESAPVTTPTMASIPPRIKVEPASEKDPESLRQSAREKEEHTQEEGTVPSRTIEEEKG    351 - 420
TIFARPAAPPIWPSVPISTPSGEPLEVTEDSEDRPGKEPSAPEKKEDALMPPKLRLKRRWNDDPEARELS    421 - 490
KSGKFLWNGSGPQGLATAAADA                                                    491 - 512
//

Text Mined References (17)

PMID Year Title
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
23329352 2013 Frequent copy number gains at 1q21 and 1q32 are associated with overexpression of the ETS transcription factors ETV3 and ELF3 in breast cancer irrespective of molecular subtypes.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18951430 2008 Conduct disorder and ADHD: evaluation of conduct problems as a categorical and quantitative trait in the international multicentre ADHD genetics study.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18025162 2007 Cutting edge: A transcriptional repressor and corepressor induced by the STAT3-regulated anti-inflammatory signaling pathway.
17525531 2007 Differential repression of c-myc and cdc2 gene expression by ERF and PE-1/METS.
More...