Property Summary

NCBI Gene PubMed Count 57
PubMed Score 163.76
PubTator Score 42.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
astrocytic glioma -1.600 2.5e-03
Astrocytoma, Pilocytic 1.100 2.8e-03
Breast cancer -1.900 3.5e-15
ependymoma -1.400 6.9e-06
glioblastoma 1.400 1.4e-02
lung adenocarcinoma -1.300 3.0e-10
lung carcinoma -1.100 1.1e-05
medulloblastoma -1.400 1.2e-02
medulloblastoma, large-cell -2.500 2.0e-03
mucosa-associated lymphoid tissue lympho... 1.762 3.5e-02
osteosarcoma 2.448 1.9e-04
ovarian cancer 1.700 1.0e-05
pancreatic cancer -1.700 6.6e-05
pediatric high grade glioma 1.100 1.4e-02
pituitary cancer -1.700 1.0e-04
primary pancreatic ductal adenocarcinoma -1.831 8.0e-04
primitive neuroectodermal tumor -1.900 3.9e-02
psoriasis -2.300 1.4e-04

Protein-protein Interaction (4)

Gene RIF (43)

AA Sequence

MDGFYDQQVPFMVPGKSRSEECRGRPVIDRKRKFLDTDLAHDSEELFQDLSQLQEAWLAEAQVPDDEQFV      1 - 70
PDFQSDNLVLHAPPPTKIKRELHSPSSELSSCSHEQALGANYGEKCLYNYCAYDRKPPSGFKPLTPPTTP     71 - 140
LSPTHQNPLFPPPQATLPTSGHAPAAGPVQGVGPAPAPHSLPEPGPQQQTFAVPRPPHQPLQMPKMMPEN    141 - 210
QYPSEQRFQRQLSEPCHPFPPQPGVPGDNRPSYHRQMSEPIVPAAPPPPQGFKQEYHDPLYEHGVPGMPG    211 - 280
PPAHGFQSPMGIKQEPRDYCVDSEVPNCQSSYMRGGYFSSSHEGFSYEKDPRLYFDDTCVVPERLEGKVK    281 - 350
QEPTMYREGPPYQRRGSLQLWQFLVTLLDDPANAHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYD    351 - 420
KLSRSLRYYYEKGIMQKVAGERYVYKFVCDPDALFSMAFPDNQRPFLKAESECHLSEEDTLPLTHFEDSP    421 - 490
AYLLDMDRCSSLPYAEGFAY                                                      491 - 510
//

Text Mined References (62)

PMID Year Title