Property Summary

NCBI Gene PubMed Count 51
Grant Count 33
R01 Count 23
Funding $2,891,203.16
PubMed Score 156.70
PubTator Score 42.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
astrocytic glioma -1.600 0.002
psoriasis -2.300 0.000
osteosarcoma 2.448 0.000
posterior fossa group B ependymoma -1.900 0.000
glioblastoma 1.700 0.003
medulloblastoma -1.400 0.012
medulloblastoma, large-cell -2.500 0.002
primitive neuroectodermal tumor -1.900 0.039
primary pancreatic ductal adenocarcinoma -1.831 0.001
lung adenocarcinoma -1.300 0.000
pediatric high grade glioma 1.200 0.015
pilocytic astrocytoma 1.100 0.003
lung carcinoma -1.100 0.000
Breast cancer -1.900 0.000
mucosa-associated lymphoid tissue lympho... 1.762 0.035
ovarian cancer 1.700 0.000
pituitary cancer -1.700 0.000
pancreatic cancer -1.700 0.000

Gene RIF (37)

PMID Text
26289026 ERM proteins contribute toward accelerated CD44 shedding by MT1-MMP through ERM protein-mediated interactions between their cytoplasmic tails.
25924802 Increase of ETV5 protein expression is associated with endometrial cancer invasion.
25801911 Our results reveal a novel ERM-based spatial mechanism that is coopted by DLBCL cells to sustain tumor cell growth and survival.
25203299 developed a novel RNA in situ hybridization-based assay for the in situ detection of ETV1, ETV4, and ETV5 in formalin-fixed paraffin-embedded tissues from prostate needle biopsies, prostatectomy, and metastatic PCa specimens using RNA probes
25172658 Snail regulates the motility and invasiveness of oral cancer cells via RhoA/Cdc42/p-ERM pathway.
24756106 there is a higher expression of ERM/ETV5 in early stages of endometrioid endometrial carcinomas
24667918 Microarray analysis indicates HIV-1 Tat-induced downregulation of ets variant 5 (ETV5) in primary human brain microvascular endothelial cells
22968857 This data suggests that ETV5 has a significant role in regulating MMP2 expression and therefore matrix resorption in human chondrosarcoma, and thus may be a targetable upstream effector of the metastatic cascade in this cancer.
22771031 The homozygous +48845 G>T (TT allele) variant confers a higher risk for male infertility associated with nonobstructive azoospermia and Sertoli cell only syndrome in Australian men.
22589409 we found that the downregulation of ETV5 reduced the expression of the oncogenic transcription factor FOXM1.
More...

AA Sequence

MDGFYDQQVPFMVPGKSRSEECRGRPVIDRKRKFLDTDLAHDSEELFQDLSQLQEAWLAEAQVPDDEQFV      1 - 70
PDFQSDNLVLHAPPPTKIKRELHSPSSELSSCSHEQALGANYGEKCLYNYCAYDRKPPSGFKPLTPPTTP     71 - 140
LSPTHQNPLFPPPQATLPTSGHAPAAGPVQGVGPAPAPHSLPEPGPQQQTFAVPRPPHQPLQMPKMMPEN    141 - 210
QYPSEQRFQRQLSEPCHPFPPQPGVPGDNRPSYHRQMSEPIVPAAPPPPQGFKQEYHDPLYEHGVPGMPG    211 - 280
PPAHGFQSPMGIKQEPRDYCVDSEVPNCQSSYMRGGYFSSSHEGFSYEKDPRLYFDDTCVVPERLEGKVK    281 - 350
QEPTMYREGPPYQRRGSLQLWQFLVTLLDDPANAHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYD    351 - 420
KLSRSLRYYYEKGIMQKVAGERYVYKFVCDPDALFSMAFPDNQRPFLKAESECHLSEEDTLPLTHFEDSP    421 - 490
AYLLDMDRCSSLPYAEGFAY                                                      491 - 510
//

Text Mined References (55)

PMID Year Title
26289026 2015 MT1-MMP recognition by ERM proteins and its implication in CD44 shedding.
25924802 2015 Nidogen 1 and Nuclear Protein 1: novel targets of ETV5 transcription factor involved in endometrial cancer invasion.
25801911 2015 Identification of Ezrin-Radixin-Moesin proteins as novel regulators of pathogenic B-cell receptor signaling and tumor growth in diffuse large B-cell lymphoma.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25203299 2014 Novel RNA hybridization method for the in situ detection of ETV1, ETV4, and ETV5 gene fusions in prostate cancer.
25172658 2014 Snail regulates the motility of oral cancer cells via RhoA/Cdc42/p-ERM pathway.
24756106 2014 ERM/ETV5 and RUNX1/AML1 expression in endometrioid adenocarcinomas of endometrium and association with neoplastic progression.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22968857 2013 ETV5 as a regulator of matrix metalloproteinase 2 in human chondrosarcoma.
More...