Property Summary

NCBI Gene PubMed Count 1,467
PubMed Score 16050.74
PubTator Score 6432.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
diabetes mellitus 1728 6.88 3.4

Expression

  Differential Expression (9)

Disease log2 FC p
Atopic dermatitis -2.000 1.1e-02
autosomal dominant Emery-Dreifuss muscul... 1.477 1.0e-02
breast carcinoma -2.200 3.2e-02
ductal carcinoma in situ -5.000 5.7e-04
facioscapulohumeral dystrophy -1.800 4.9e-02
fibroadenoma -3.700 2.6e-02
invasive ductal carcinoma -6.300 1.5e-04
ovarian cancer -1.800 5.5e-06
psoriasis 1.300 1.7e-02

Protein-protein Interaction (3)

Gene RIF (1481)

AA Sequence

MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPIL      1 - 70
TLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGY     71 - 140
STEVVALSRLQGSLQDMLWQLDLSPGC                                               141 - 167
//

Text Mined References (1473)

PMID Year Title