Property Summary

NCBI Gene PubMed Count 61
Grant Count 211
R01 Count 163
Funding $35,011,439.82
PubMed Score 501.08
PubTator Score 186.40

Knowledge Summary

Patent (44,848)

Expression

Synonym

Accession P41146 Q8TD34 Q8WYH9 Q9H4K4
Symbols NOP
OOR
NOPr
ORL1
KOR-3
NOCIR

Gene

PANTHER Protein Class (2)

PDB

4EA3   5DHG   5DHH  

  TechDev Info (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
652083 other 0 / 0 / 0 Late-stage results from the probe development effort to identify antagonists of OPRK1: CEREP radiometric-based biochemical counterscreen panel assay

Gene RIF (37)

PMID Text
26349406 Study presents evidence suggesting that the PNOC and OPRL1 are dysregulated in suicide completers, thereby potentially contributing to impaired emotional and behavioral control and, ultimately, to the suicidal crisis
25677778 Data suggest that nociceptin/nociceptin receptor signaling in neurons of the hippocampus modulate learning and memory. [REVIEW]
25677777 Data suggest that interaction between the nociceptin/nociceptin receptor system and the orexin/orexin receptor system in neurons of the hypothalamus positively and negatively modulate complex and integrated responses to stress. [REVIEW]
25677776 Data suggest that the nociceptin/nociceptin receptor system is involved in modulation of psychological and inflammatory stress responses and in pathogenesis of anxiety. [REVIEW]
25677775 Data suggest that the nociceptin/nociceptin receptor system is involved in modulation of the immune response and in pathogenesis of autoimmune diseases. [REVIEW]
25677773 Opioid neuropeptide systems are important mediators of ovarian steroid signaling that regulate reproduction in female; data suggest that nociceptin and nociceptin receptor system in arcuate nucleus of hypothalamus is such a system. [REVIEW]
25677768 Data suggest that nociceptin and nociceptin receptor evolved as one of 4 opioid receptor systems in vertebrates; this system exhibits both analgesic and hyperalgesic effects. [REVIEW]
23799031 Overall methylation levels in the promoter regions of three genes (ALDH1A1, OPRL1 and RGS19) are elevated in subjects who were exposed to childhood adversity.
23740899 Oprl1 is associated with amygdala function, fear processing, and posttraumatic stress disorder symptoms.
23086955 Dominant-positive Arrestin3 but not Arrestin2 was sufficient to rescue NOPR-S363A internalization and JNK signaling.
More...

AA Sequence

MEPLFPAPFWEVIYGSHLQGNLSLLSPNHSLLPPHLLLNASHGAFLPLGLKVTIVGLYLAVCVGGLLGNC      1 - 70
LVMYVILRHTKMKTATNIYIFNLALADTLVLLTLPFQGTDILLGFWPFGNALCKTVIAIDYYNMFTSTFT     71 - 140
LTAMSVDRYVAICHPIRALDVRTSSKAQAVNVAIWALASVVGVPVAIMGSAQVEDEEIECLVEIPTPQDY    141 - 210
WGPVFAICIFLFSFIVPVLVISVCYSLMIRRLRGVRLLSGSREKDRNLRRITRLVLVVVAVFVGCWTPVQ    211 - 280
VFVLAQGLGVQPSSETAVAILRFCTALGYVNSCLNPILYAFLDENFKACFRKFCCASALRRDVQVSDRVR    281 - 350
SIAKDVALACKTSETVPRPA                                                      351 - 370
//

Text Mined References (61)

PMID Year Title
26349406 2015 Decreased expression of nociceptin/orphanin FQ in the dorsal anterior cingulate cortex of suicides.
25677778 2015 Nociceptin/orphanin-FQ modulation of learning and memory.
25677777 2015 The neuronal circuit between nociceptin/orphanin FQ and hypocretins/orexins coordinately modulates stress-induced analgesia and anxiety-related behavior.
25677776 2015 Endogenous nociceptin system involvement in stress responses and anxiety behavior.
25677775 2015 Nociceptin/orphanin FQ-NOP receptor system in inflammatory and immune-mediated diseases.
25677773 2015 Orphanin FQ-ORL-1 regulation of reproduction and reproductive behavior in the female.
25677768 2015 Bioinformatics and evolution of vertebrate nociceptin and opioid receptors.
25013167 2014 Evidence of efficient stop codon readthrough in four mammalian genes.
23799031 2013 Profiling of childhood adversity-associated DNA methylation changes in alcoholic patients and healthy controls.
23740899 2013 Amygdala-dependent fear is regulated by Oprl1 in mice and humans with PTSD.
More...