Property Summary

Ligand Count 945
NCBI Gene PubMed Count 63
PubMed Score 516.18
PubTator Score 186.40

Knowledge Summary

Patent (44,848)

Expression

Protein-protein Interaction (1)

Gene RIF (39)

AA Sequence

MEPLFPAPFWEVIYGSHLQGNLSLLSPNHSLLPPHLLLNASHGAFLPLGLKVTIVGLYLAVCVGGLLGNC      1 - 70
LVMYVILRHTKMKTATNIYIFNLALADTLVLLTLPFQGTDILLGFWPFGNALCKTVIAIDYYNMFTSTFT     71 - 140
LTAMSVDRYVAICHPIRALDVRTSSKAQAVNVAIWALASVVGVPVAIMGSAQVEDEEIECLVEIPTPQDY    141 - 210
WGPVFAICIFLFSFIVPVLVISVCYSLMIRRLRGVRLLSGSREKDRNLRRITRLVLVVVAVFVGCWTPVQ    211 - 280
VFVLAQGLGVQPSSETAVAILRFCTALGYVNSCLNPILYAFLDENFKACFRKFCCASALRRDVQVSDRVR    281 - 350
SIAKDVALACKTSETVPRPA                                                      351 - 370
//

Text Mined References (63)

PMID Year Title