Property Summary

NCBI Gene PubMed Count 87
Grant Count 142
R01 Count 70
Funding $24,190,308.78
PubMed Score 289.80
PubTator Score 692.59

Knowledge Summary

Patent (7,765)

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -2.600 0.004
ependymoma -2.900 0.004
oligodendroglioma -2.400 0.009
glioblastoma -2.700 0.000
medulloblastoma -2.800 0.000
atypical teratoid / rhabdoid tumor -2.100 0.000
medulloblastoma, large-cell -2.700 0.000
pediatric high grade glioma -2.200 0.000
pilocytic astrocytoma -2.500 0.000

Synonym

Accession P41145 E5RHC9 Q499G4 K-OR-1
Symbols KOR
OPRK
KOR-1
K-OR-1

Gene

PANTHER Protein Class (2)

PDB

2A0D   2IQN   4DJH  

  TechDev Info (1)

MLP Assay (32)

AID Type Active / Inconclusive / Inactive Description
1777 confirmatory 51 / 0 / 284169 uHTS identification of small molecule agonists of the kappa opioid receptor via a luminescent beta-arrestin assay
1778 confirmatory 265 / 0 / 290244 uHTS identification of small molecule antagonists of the kappa opioid receptor via a luminescent beta-arrestin assay
1785 summary 2 / 0 / 0 Summary of small molecule antagonists of the kappa opioid receptor
1786 summary 2 / 0 / 0 Summary of small molecule agonists of the kappa opioid receptor
1788 other 0 / 0 / 0 Discovery of novel allosteric modulators of the M1 muscarinic receptor: Agonist Ancillary Activity
1921 other 2 / 0 / 0 Discovery of a Highly Selective in vitro and in vivo M4 Positive Allosteric Modulator: Ancillary Activity
2133 confirmatory 24 / 0 / 13 HTS Image-Based Screen for Selective Agonists of the KOR Receptor
2136 confirmatory 44 / 0 / 166 HTS Image-Based Screen for Selective Antagonists of the KOR Receptor
2284 confirmatory 15 / 0 / 15 SAR analysis of small molecule agonists of the kappa opioid receptor via a luminescent beta-arrestin assay
2285 confirmatory 12 / 0 / 20 SAR analysis of small molecule antagonists of the kappa opioid receptor via a luminescent beta-arrestin assay
More...

Gene RIF (76)

PMID Text
26692286 data provide evidence for genetic modulation of opioid withdrawal severity.
26372966 The structure of the dynorphin (1-13) peptide (dynorphin) bound to the human kappa opioid receptor (KOR) has been determined by liquid-state NMR spectroscopy.
26300544 OPRK1 promoter hypermethylation might increase the risk of AD through its regulation on the gene expression of OPRK1.
26233486 findings suggest that SNPs in opioid receptors and the PNOC genes are associated with NAS severity.
25866368 OX1R and KOR heterodimerize, and this heterodimer associates with Galphas, leading to increased protein kinase A (PKA) signaling pathway activity, including upregulation of intracellular cAMP levels.
25293321 Here we describe three experimental procedures we used to evaluate the interaction between hKOPR and 14-3-3zeta: co-immunoprecipitation, pull-down assay and immunofluorescence microscopy.
25289860 RGS2 and RGS4 are new interacting partners that play key roles in G protein coupling to negatively regulate kappa-OmicronR signaling.
25241033 Low OPRK1 expression is associated with liver metastases of small bowel neuroendocrine tumors.
25229257 Results suggest that Kappa receptor availability in an amygdala-cingulate cortex-striatal circuit mediates the phenotypic expression of trauma-related loss (ie, dysphoria) symptoms.
25177835 Studied differential DNA-protein interactions of PDYN and OPRK1 SNPs significantly associated with alcohol dependence.
More...

AA Sequence

MDSPIQIFRGEPGPTCAPSACLPPNSSAWFPGWAEPDSNGSAGSEDAQLEPAHISPAIPVIITAVYSVVF      1 - 70
VVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSTVYLMNSWPFGDVLCKIVISIDYY     71 - 140
NMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINICIWLLSSSVGISAIVLGGTKVREDVDVIEC    141 - 210
SLQFPDDDYSWWDLFMKICVFIFAFVIPVLIIIVCYTLMILRLKSVRLLSGSREKDRNLRRITRLVLVVV    211 - 280
AVFVVCWTPIHIFILVEALGSTSHSTAALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFRDFCFPLKM    281 - 350
RMERQSTSRVRNTVQDPAYLRDIDGMNKPV                                            351 - 380
//

Text Mined References (90)

PMID Year Title
26692286 2016 Searching for evidence of genetic mediation of opioid withdrawal by opioid receptor gene polymorphisms.
26372966 2015 NMR structure and dynamics of the agonist dynorphin peptide bound to the human kappa opioid receptor.
26300544 2015 OPRK1 promoter hypermethylation increases the risk of Alzheimer's disease.
26233486 2015 Variations in opioid receptor genes in neonatal abstinence syndrome.
25866368 2015 Heterodimerization of human orexin receptor 1 and kappa opioid receptor promotes protein kinase A/cAMP-response element binding protein signaling via a G?s-mediated mechanism.
25293321 2015 Identification and verification of proteins interacting with the kappa opioid receptor (KOPR).
25289860 2015 RGS2 and RGS4 proteins: New modulators of the ?-opioid receptor signaling.
25241033 2014 Gene expression accurately distinguishes liver metastases of small bowel and pancreas neuroendocrine tumors.
25229257 2014 Association of in vivo ?-opioid receptor availability and the transdiagnostic dimensional expression of trauma-related psychopathology.
25177835 2014 A molecular prospective provides new insights into implication of PDYN and OPRK1 genes in alcohol dependence.
More...