Property Summary

Ligand Count 1,612
NCBI Gene PubMed Count 114
PubMed Score 103.91
PubTator Score 83.55

Knowledge Summary

Patent (2,943)

TINX Plot

  Disease (8)

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma -1.800 1.1e-03
Astrocytoma, Pilocytic -1.400 7.9e-04
atypical teratoid / rhabdoid tumor -2.000 2.4e-06
ependymoma -1.900 1.0e-03
group 4 medulloblastoma -1.300 2.8e-02
oligodendroglioma -1.700 1.4e-03
primitive neuroectodermal tumor -1.900 4.2e-03

 GWAS Trait (1)

Gene RIF (90)

AA Sequence

MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVCAVGLLGNVLV      1 - 70
MFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELLCKAVLSIDYYNMFTSIFTLT     71 - 140
MMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVGVPIMVMAVTRPRDGAVVCMLQFPSPSWYWD    141 - 210
TVTKICVFLFAFVVPILIITVCYGLMLLRLRSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIF    211 - 280
VIVWTLVDIDRRDPLVVAALHLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRARE    281 - 350
ATARERVTACTPSDGPGGGAAA                                                    351 - 372
//

Text Mined References (115)

PMID Year Title