Property Summary

NCBI Gene PubMed Count 107
Grant Count 22
R01 Count 10
Funding $2,679,592.84
PubMed Score 93.00
PubTator Score 83.55

Knowledge Summary

Patent (2,943)

 GWAS Trait (1)

MLP Assay (40)

AID Type Active / Inconclusive / Inactive Description
1788 other 0 / 0 / 0 Discovery of novel allosteric modulators of the M1 muscarinic receptor: Agonist Ancillary Activity
1921 other 2 / 0 / 0 Discovery of a Highly Selective in vitro and in vivo M4 Positive Allosteric Modulator: Ancillary Activity
2343 confirmatory 1 / 0 / 131 HTS Image-Based Screen for Agonists of the DOR Receptor
2356 confirmatory 3 / 0 / 129 HTS Image-Based Screen for Antagonists of the DOR Receptor
2357 confirmatory 1 / 0 / 61 SAR Analysis of Antagonists of the DOR Receptor using an Image-Based Assay
2370 confirmatory 1 / 0 / 61 SAR Analysis of Agonists of the DOR Receptor using an Image-Based Assay
2493 confirmatory 0 / 0 / 16 SAR Analysis of Agonists of the DOR Receptor using an Image-Based Assay - Set 2
2498 confirmatory 0 / 0 / 20 SAR Analysis of Antagonists of the DOR Receptor using an Image-Based Assay - Set 2
434974 screening 0 / 0 / 0 Late-stage radioligand binding assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen
488824 confirmatory 0 / 0 / 34 SAR Analysis of Agonists of the DOR Receptor using an Image-Based Assay - Set 3
More...

Gene RIF (83)

PMID Text
26549838 the expression of DOR was upregulated in the drugresistant human hepatocellular carcinoma cells.
26402014 Results suggest deltaOR-Phe27Cys variation modulates beta- and gamma-secretase activity in late-stage Alzheimer's disease likely via post-translational mechanisms
26233486 findings suggest that SNPs in opioid receptors and the PNOC genes are associated with NAS severity.
26211551 OPRD-mediated activation of ERK1/2 is via ligand-specific transactivation of EGFR.
25439010 We have established a delta opioid receptor-PKC-Nrf2 axis as a part of the mechanism underlying cytoprotection against hypoxia/reoxygenation injury
25178105 Analysis of the transcription factor POU2F3 revealed a DOPr-mediated extracellular signal-regulated kinase (ERK)-dependent downregulation of this factorThe delta-opioid receptor affects epidermal homeostasis
24798333 Taken together, the hdeltaOR appears to rely primarily on the CNX-mediated N-glycan-dependent QC that has the capacity to assist in folding
24628261 Activation of the delta opioid receptor promotes cutaneous wound healing by affecting keratinocyte intercellular adhesion and migration
24413399 crystal structure of the human delta-opioid receptor (delta-OR), revealing the presence and fundamental role of a sodium ion in mediating allosteric control of receptor functional selectivity and constitutive activity
24126707 findings suggest that rs581111 and rs52920 may be useful when considering treatment options for female opioid addicts, however, confirmation in an independent sample is warranted
More...

AA Sequence

MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVCAVGLLGNVLV      1 - 70
MFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELLCKAVLSIDYYNMFTSIFTLT     71 - 140
MMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVGVPIMVMAVTRPRDGAVVCMLQFPSPSWYWD    141 - 210
TVTKICVFLFAFVVPILIITVCYGLMLLRLRSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIF    211 - 280
VIVWTLVDIDRRDPLVVAALHLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRARE    281 - 350
ATARERVTACTPSDGPGGGAAA                                                    351 - 372
//

Text Mined References (108)

PMID Year Title
26549838 2016 Downregulation of ? opioid receptor by RNA interference enhances the sensitivity of BEL/FU drug?resistant human hepatocellular carcinoma cells to 5?FU.
26402014 2015 Genetic Variation in ?-Opioid Receptor Associates with Increased ?- and ?-Secretase Activity in the Late Stages of Alzheimer's Disease.
26233486 2015 Variations in opioid receptor genes in neonatal abstinence syndrome.
26211551 2015 Role for engagement of ?-arrestin2 by the transactivated EGFR in agonist-specific regulation of ? receptor activation of ERK1/2.
25439010 2015 A novel mechanism for cytoprotection against hypoxic injury: ?-opioid receptor-mediated increase in Nrf2 translocation.
25178105 2015 The ?-opioid receptor affects epidermal homeostasis via ERK-dependent inhibition of transcription factor POU2F3.
24798333 2014 N-Glycan-dependent and -independent quality control of human ? opioid receptor N-terminal variants.
24628261 2015 Activation of the ?-opioid receptor promotes cutaneous wound healing by affecting keratinocyte intercellular adhesion and migration.
24613828 2014 ?-Opioid receptor activation reduces ?-synuclein overexpression and oligomer formation induced by MPP(+) and/or hypoxia.
24413399 2014 Molecular control of ?-opioid receptor signalling.
More...