Property Summary

NCBI Gene PubMed Count 25
PubMed Score 31.08
PubTator Score 40.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
juvenile dermatomyositis 1189 1.67245007076086E-12
acute quadriplegic myopathy 1157 2.38740474016567E-7
ovarian cancer 8492 4.09784444174776E-6
Duchenne muscular dystrophy 602 1.63677823240605E-5
sonic hedgehog group medulloblastoma 1482 2.01922856145187E-5
fascioscapulohumeral muscular dystrophy 100 4.33474449221469E-5
osteosarcoma 7933 4.39000431570434E-4
Disease Target Count Z-score Confidence
Intellectual disability 573 0.0 4.0
Disease Target Count Z-score Confidence
Microcephaly 149 3.66 1.8

Expression

  Differential Expression (7)

Synonym

Accession P41091 A0A024RBY4 A8K2Y2 B2R5N2 B5BTZ4 Q53HK3
Symbols EIF2
EIF2G
MRXSBRK
eIF-2gA
EIF2gamma

Gene

  Ortholog (5)

Species Source
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid

Gene RIF (7)

PMID Text
23166591 Expression of HIV-1 Tat upregulates the abundance of eukaryotic translation initiation factor 2, subunit 3 gamma (EIF2S3) in the nucleoli of Jurkat T-cells
23063529 The human X-chromosomal neurological disorder characterized by intellectual disability and microcephaly is caused by a missense mutation in eIF2gamma (encoded by EIF2S3), the core subunit of the heterotrimeric eIF2 complex.
22174317 Expression of HIV-1 Tat upregulates the abundance of eukaryotic translation initiation factor 2, subunit 3 gamma (EIF2S3) in the nucleoli of Jurkat T-cells
19723899 Observational study of gene-disease association. (HuGE Navigator)
10648795 Expression of HIV-1 Tat upregulates the abundance of eukaryotic translation initiation factor 2, subunit 3 gamma (EIF2S3) in the nucleoli of Jurkat T-cells
10620360 Expression of HIV-1 Tat upregulates the abundance of eukaryotic translation initiation factor 2, subunit 3 gamma (EIF2S3) in the nucleoli of Jurkat T-cells
9079663 Expression of HIV-1 Tat upregulates the abundance of eukaryotic translation initiation factor 2, subunit 3 gamma (EIF2S3) in the nucleoli of Jurkat T-cells

AA Sequence

MAGGEAGVTLGQPHLSRQDLTTLDVTKLTPLSHEVISRQATINIGTIGHVAHGKSTVVKAISGVHTVRFK      1 - 70
NELERNITIKLGYANAKIYKLDDPSCPRPECYRSCGSSTPDEFPTDIPGTKGNFKLVRHVSFVDCPGHDI     71 - 140
LMATMLNGAAVMDAALLLIAGNESCPQPQTSEHLAAIEIMKLKHILILQNKIDLVKESQAKEQYEQILAF    141 - 210
VQGTVAEGAPIIPISAQLKYNIEVVCEYIVKKIPVPPRDFTSEPRLIVIRSFDVNKPGCEVDDLKGGVAG    211 - 280
GSILKGVLKVGQEIEVRPGIVSKDSEGKLMCKPIFSKIVSLFAEHNDLQYAAPGGLIGVGTKIDPTLCRA    281 - 350
DRMVGQVLGAVGALPEIFTELEISYFLLRRLLGVRTEGDKKAAKVQKLSKNEVLMVNIGSLSTGGRVSAV    351 - 420
KADLGKIVLTNPVCTEVGEKIALSRRVEKHWRLIGWGQIRRGVTIKPTVDDD                      421 - 472
//

Text Mined References (29)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
23063529 2012 eIF2? mutation that disrupts eIF2 complex integrity links intellectual disability to impaired translation initiation.
21269460 2011 Initial characterization of the human central proteome.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19723899 2009 Association of the X-chromosomal genes TIMP1 and IL9R with rheumatoid arthritis.
19054851 2008 Human protein factory for converting the transcriptome into an in vitro-expressed proteome,.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17220478 2007 Proteomics analysis of the interactome of N-myc downstream regulated gene 1 and its interactions with the androgen response program in prostate cancer cells.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
More...