Property Summary

NCBI Gene PubMed Count 27
PubMed Score 30.41
PubTator Score 40.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
acute quadriplegic myopathy 2.067 2.4e-07
Duchenne muscular dystrophy 1.100 1.6e-05
fascioscapulohumeral muscular dystrophy 1.034 4.3e-05
juvenile dermatomyositis 1.687 1.7e-12
osteosarcoma -1.016 4.4e-04
ovarian cancer -1.500 1.8e-04
sonic hedgehog group medulloblastoma 1.400 2.0e-05

Protein-protein Interaction (1)

Gene RIF (9)

AA Sequence

MAGGEAGVTLGQPHLSRQDLTTLDVTKLTPLSHEVISRQATINIGTIGHVAHGKSTVVKAISGVHTVRFK      1 - 70
NELERNITIKLGYANAKIYKLDDPSCPRPECYRSCGSSTPDEFPTDIPGTKGNFKLVRHVSFVDCPGHDI     71 - 140
LMATMLNGAAVMDAALLLIAGNESCPQPQTSEHLAAIEIMKLKHILILQNKIDLVKESQAKEQYEQILAF    141 - 210
VQGTVAEGAPIIPISAQLKYNIEVVCEYIVKKIPVPPRDFTSEPRLIVIRSFDVNKPGCEVDDLKGGVAG    211 - 280
GSILKGVLKVGQEIEVRPGIVSKDSEGKLMCKPIFSKIVSLFAEHNDLQYAAPGGLIGVGTKIDPTLCRA    281 - 350
DRMVGQVLGAVGALPEIFTELEISYFLLRRLLGVRTEGDKKAAKVQKLSKNEVLMVNIGSLSTGGRVSAV    351 - 420
KADLGKIVLTNPVCTEVGEKIALSRRVEKHWRLIGWGQIRRGVTIKPTVDDD                      421 - 472
//

Text Mined References (31)

PMID Year Title