Property Summary

NCBI Gene PubMed Count 72
Grant Count 342
R01 Count 154
Funding $67,241,813.38
PubMed Score 629.37
PubTator Score 388.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
cutaneous lupus erythematosus -3.100 0.006
psoriasis 1.100 0.000

Synonym

Accession P40967 B3KS57 B7Z6D7 Q12763 Q14448 Q14817 Q16565
Symbols P1
SI
SIL
ME20
P100
SILV
ME20M
gp100
ME20-M
PMEL17
D12S53E

Gene

PDB

1TVB   1TVH   3CC5   4IS6   5EU3   5EU4   5EU6  

Gene RIF (49)

PMID Text
26917722 These findings help to clarify the mechanism of T-cell recognition of gp100 during melanoma responses and could direct the development of altered peptides for vaccination.
26694611 Data suggest that the Kringle-like domain of PMEL facilitates post-endoplasmic reticulum processing of disulfide-bonded PMEL dimers and promotes formation of PMEL functional amyloid fibrillar structures within multivesicular endosomes.
26507656 mutant N-terminally extended peptides exhibited significantly increased HLA-A*02:01 binding affinity and elicited CD8(+) T cell stimulation in vitro similar to the wtgp100209-217 epitope.
25451784 Data indicate that repeat domain (RPT) derived from Pmel17 aggregation kinetics were influenced only by lysolipid-containing phospholipid vesicles.
24650003 Melanosome-autonomous regulation of size and number: the OA1 receptor sustains PMEL expression.
24040098 SIL-TAL1 rearrangement identifies a distinct subtype with inferior outcome which could allow for individual therapeutic stratification for T-ALL patients.
23754390 BACE2 cleaves the integral membrane form of PMEL within the juxtamembrane domain, releasing the PMEL luminal domain into endosomal precursors for the formation of amyloid fibrils and downstream melanosome morphogenesis.
23643172 The recombinant Pmel 17 plasmids were right as we expected by DNA sequencing
23452376 the molecular basis for the distinct trafficking and morphogenetic properties of PMEL and GPNMB is the PKD domain
23389629 Data indicat that the N-terminal region of PMEL/Pmel17 is essential for the formation of melanosomal fibrils.
More...

AA Sequence

MDLVLKRCLLHLAVIGALLAVGATKVPRNQDWLGVSRQLRTKAWNRQLYPEWTEAQRLDCWRGGQVSLKV      1 - 70
SNDGPTLIGANASFSIALNFPGSQKVLPDGQVIWVNNTIINGSQVWGGQPVYPQETDDACIFPDGGPCPS     71 - 140
GSWSQKRSFVYVWKTWGQYWQVLGGPVSGLSIGTGRAMLGTHTMEVTVYHRRGSRSYVPLAHSSSAFTIT    141 - 210
DQVPFSVSVSQLRALDGGNKHFLRNQPLTFALQLHDPSGYLAEADLSYTWDFGDSSGTLISRALVVTHTY    211 - 280
LEPGPVTAQVVLQAAIPLTSCGSSPVPGTTDGHRPTAEAPNTTAGQVPTTEVVGTTPGQAPTAEPSGTTS    281 - 350
VQVPTTEVISTAPVQMPTAESTGMTPEKVPVSEVMGTTLAEMSTPEATGMTPAEVSIVVLSGTTAAQVTT    351 - 420
TEWVETTARELPIPEPEGPDASSIMSTESITGSLGPLLDGTATLRLVKRQVPLDCVLYRYGSFSVTLDIV    421 - 490
QGIESAEILQAVPSGEGDAFELTVSCQGGLPKEACMEISSPGCQPPAQRLCQPVLPSPACQLVLHQILKG    491 - 560
GSGTYCLNVSLADTNSLAVVSTQLIMPGQEAGLGQVPLIVGILLVLMAVVLASLIYRRRLMKQDFSVPQL    561 - 630
PHSSSHWLRLPRIFCSCPIGENSPLLSGQQV                                           631 - 661
//

Text Mined References (73)

PMID Year Title
26917722 2016 A Molecular Switch Abrogates Glycoprotein 100 (gp100) T-cell Receptor (TCR) Targeting of a Human Melanoma Antigen.
26694611 2016 The Kringle-like Domain Facilitates Post-endoplasmic Reticulum Changes to Premelanosome Protein (PMEL) Oligomerization and Disulfide Bond Configuration and Promotes Amyloid Formation.
26507656 2015 The T210M Substitution in the HLA-a*02:01 gp100 Epitope Strongly Affects Overall Proteasomal Cleavage Site Usage and Antigen Processing.
25451784 2014 Lysophospholipid-containing membranes modulate the fibril formation of the repeat domain of a human functional amyloid, pmel17.
24650003 2014 Melanosome-autonomous regulation of size and number: the OA1 receptor sustains PMEL expression.
24040098 2013 SIL-TAL1 rearrangement is related with poor outcome: a study from a Chinese institution.
23754390 2013 BACE2 processes PMEL to form the melanosome amyloid matrix in pigment cells.
23643172 2013 [Detection of serum autoantibodies against premelanosome protein 17 increases in the vitiligo patients].
23452376 2013 The PKD domain distinguishes the trafficking and amyloidogenic properties of the pigment cell protein PMEL and its homologue GPNMB.
23389629 2013 Critical residues in the PMEL/Pmel17 N-terminus direct the hierarchical assembly of melanosomal fibrils.
More...