Property Summary

NCBI Gene PubMed Count 42
PubMed Score 19.66
PubTator Score 12.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
acute myeloid leukemia -1.100 2.8e-02
adult high grade glioma 1.300 6.8e-04
atypical teratoid / rhabdoid tumor 1.300 1.6e-03
colon cancer 1.400 2.6e-02
group 3 medulloblastoma 1.700 3.2e-03
intraductal papillary-mucinous carcinoma... 1.500 3.9e-02
intraductal papillary-mucinous neoplasm ... 2.200 4.3e-03
lung cancer 2.100 2.7e-05
malignant mesothelioma 1.400 7.2e-07
medulloblastoma, large-cell 1.600 2.6e-04
nasopharyngeal carcinoma 1.100 2.4e-04
non-small cell lung cancer 1.020 1.1e-12
osteosarcoma 1.670 7.4e-03
ovarian cancer 1.200 4.0e-07
pituitary cancer 1.100 3.5e-04
primitive neuroectodermal tumor 1.200 3.7e-03
psoriasis 1.300 1.1e-10

 GO Function (1)

Gene RIF (14)

AA Sequence

MSLWVDKYRPCSLGRLDYHKEQAAQLRNLVQCGDFPHLLVYGPSGAGKKTRIMCILRELYGVGVEKLRIE      1 - 70
HQTITTPSKKKIEISTIASNYHLEVNPSDAGNSDRVVIQEMLKTVAQSQQLETNSQRDFKVVLLTEVDKL     71 - 140
TKDAQHALRRTMEKYMSTCRLILCCNSTSKVIPPIRSRCLAVRVPAPSIEDICHVLSTVCKKEGLNLPSQ    141 - 210
LAHRLAEKSCRNLRKALLMCEACRVQQYPFTADQEIPETDWEVYLRETANAIVSQQTPQRLLEVRGRLYE    211 - 280
LLTHCIPPEIIMKGLLSELLHNCDGQLKGEVAQMAAYYEHRLQLGSKAIYHLEAFVAKFMALYKKFMEDG    281 - 350
LEGMMF                                                                    351 - 356
//

Text Mined References (47)

PMID Year Title