Property Summary

NCBI Gene PubMed Count 42
PubMed Score 19.52
PubTator Score 12.56

Knowledge Summary

Patent

No data available

Expression

 GO Function (1)

Gene RIF (14)

PMID Text
26464638 The expression level of RFC3 was remarkably up-regulated in ovarian cancer OVCAR-3 cells. Down-regulation of RFC3 expression arrested the cell cycle of OVCAR-3 cell in the S-phase and induced apoptosis.
26397132 The expression level of RFC3 was markedly upregulated in the HCC tissues and cells.
25541153 High RFC3 expression is associated with neoplastic myelopoiesis.
25030735 our findings suggest that RFC3 protein is an important and independent biomarker with prognostic implications for patients with ovarian carcinoma.
22949521 9-cis-RA-activated RXRalpha suppresses the growth of retinoid-sensitive breast cancer and embryonic cells through RFC3.
22328562 Data identified RFC3 as a candidate oncogene amplified in esophageal adenocarcinoma (EAC).
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20574454 Observational study of gene-disease association. (HuGE Navigator)
20573375 RFC3 mutation and loss of RFC3 expression occur in large fractions of gastric and colorectal cancers and suggest that these alterations may contribute to the cancer pathogenesis by deregulating DNA repair and replication.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MSLWVDKYRPCSLGRLDYHKEQAAQLRNLVQCGDFPHLLVYGPSGAGKKTRIMCILRELYGVGVEKLRIE      1 - 70
HQTITTPSKKKIEISTIASNYHLEVNPSDAGNSDRVVIQEMLKTVAQSQQLETNSQRDFKVVLLTEVDKL     71 - 140
TKDAQHALRRTMEKYMSTCRLILCCNSTSKVIPPIRSRCLAVRVPAPSIEDICHVLSTVCKKEGLNLPSQ    141 - 210
LAHRLAEKSCRNLRKALLMCEACRVQQYPFTADQEIPETDWEVYLRETANAIVSQQTPQRLLEVRGRLYE    211 - 280
LLTHCIPPEIIMKGLLSELLHNCDGQLKGEVAQMAAYYEHRLQLGSKAIYHLEAFVAKFMALYKKFMEDG    281 - 350
LEGMMF                                                                    351 - 356
//

Text Mined References (47)

PMID Year Title
26464638 2015 ShRNA-mediated silencing of the RFC3 gene suppress ovarian tumor cells proliferation.
26397132 2015 shRNA-mediated silencing of the RFC3 gene suppresses hepatocellular carcinoma cell proliferation.
25541153 2015 Replication factor C3 is a CREB target gene that regulates cell cycle progression through the modulation of chromatin loading of PCNA.
25030735 2014 Overexpression of RFC3 is correlated with ovarian tumor development and poor prognosis.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22949521 2012 9-Cis-retinoic acid induces growth inhibition in retinoid-sensitive breast cancer and sea urchin embryonic cells via retinoid X receptor ? and replication factor C3.
22328562 2012 Integrative genomics identified RFC3 as an amplified candidate oncogene in esophageal adenocarcinoma.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
More...