Property Summary

NCBI Gene PubMed Count 42
PubMed Score 19.52
PubTator Score 12.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
malignant mesothelioma 1.900 2.8e-07
osteosarcoma 1.670 7.4e-03
sonic hedgehog group medulloblastoma 2.500 6.2e-05
atypical teratoid/rhabdoid tumor 1.400 3.7e-04
medulloblastoma, large-cell 2.300 4.5e-05
primitive neuroectodermal tumor 1.700 7.6e-04
non-small cell lung cancer 1.209 7.5e-12
intraductal papillary-mucinous carcinoma... 1.500 3.9e-02
intraductal papillary-mucinous neoplasm ... 2.200 4.3e-03
colon cancer 1.800 5.6e-04
lung cancer 2.100 2.7e-05
adult high grade glioma 1.300 6.8e-04
nasopharyngeal carcinoma 1.100 2.4e-04
psoriasis 1.300 1.1e-10
acute myeloid leukemia -1.100 2.8e-02
ovarian cancer 1.200 4.0e-07
pituitary cancer 1.100 3.5e-04

 GO Function (1)

Gene RIF (14)

PMID Text
26464638 The expression level of RFC3 was remarkably up-regulated in ovarian cancer OVCAR-3 cells. Down-regulation of RFC3 expression arrested the cell cycle of OVCAR-3 cell in the S-phase and induced apoptosis.
26397132 The expression level of RFC3 was markedly upregulated in the HCC tissues and cells.
25541153 High RFC3 expression is associated with neoplastic myelopoiesis.
25030735 our findings suggest that RFC3 protein is an important and independent biomarker with prognostic implications for patients with ovarian carcinoma.
22949521 9-cis-RA-activated RXRalpha suppresses the growth of retinoid-sensitive breast cancer and embryonic cells through RFC3.
22328562 Data identified RFC3 as a candidate oncogene amplified in esophageal adenocarcinoma (EAC).
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20574454 Observational study of gene-disease association. (HuGE Navigator)
20573375 RFC3 mutation and loss of RFC3 expression occur in large fractions of gastric and colorectal cancers and suggest that these alterations may contribute to the cancer pathogenesis by deregulating DNA repair and replication.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20226869 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19237606 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
9121429 HIV-1 Tat interacts with the RNA polymerase II holoenzyme, which includes RFC, during Tat-mediated transactivation of the HIV-1 LTR

AA Sequence

MSLWVDKYRPCSLGRLDYHKEQAAQLRNLVQCGDFPHLLVYGPSGAGKKTRIMCILRELYGVGVEKLRIE      1 - 70
HQTITTPSKKKIEISTIASNYHLEVNPSDAGNSDRVVIQEMLKTVAQSQQLETNSQRDFKVVLLTEVDKL     71 - 140
TKDAQHALRRTMEKYMSTCRLILCCNSTSKVIPPIRSRCLAVRVPAPSIEDICHVLSTVCKKEGLNLPSQ    141 - 210
LAHRLAEKSCRNLRKALLMCEACRVQQYPFTADQEIPETDWEVYLRETANAIVSQQTPQRLLEVRGRLYE    211 - 280
LLTHCIPPEIIMKGLLSELLHNCDGQLKGEVAQMAAYYEHRLQLGSKAIYHLEAFVAKFMALYKKFMEDG    281 - 350
LEGMMF                                                                    351 - 356
//

Text Mined References (47)

PMID Year Title
26464638 2015 ShRNA-mediated silencing of the RFC3 gene suppress ovarian tumor cells proliferation.
26397132 2015 shRNA-mediated silencing of the RFC3 gene suppresses hepatocellular carcinoma cell proliferation.
25541153 2015 Replication factor C3 is a CREB target gene that regulates cell cycle progression through the modulation of chromatin loading of PCNA.
25030735 2014 Overexpression of RFC3 is correlated with ovarian tumor development and poor prognosis.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22949521 2012 9-Cis-retinoic acid induces growth inhibition in retinoid-sensitive breast cancer and sea urchin embryonic cells via retinoid X receptor ? and replication factor C3.
22328562 2012 Integrative genomics identified RFC3 as an amplified candidate oncogene in esophageal adenocarcinoma.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20574454 2010 Polymorphisms in the base excision repair pathway and graft-versus-host disease.
20573375 2010 Mutational and expressional analysis of RFC3, a clamp loader in DNA replication, in gastric and colorectal cancers.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20226869 2010 Association between genetic variants in the base excision repair pathway and outcomes after hematopoietic cell transplantations.
20061627 2010 Genome-wide scan of copy number variation in late-onset Alzheimer's disease.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19237606 2009 Genetic polymorphisms in 85 DNA repair genes and bladder cancer risk.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17456004 2007 Selective translational repression of truncated proteins from frameshift mutation-derived mRNAs in tumors.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16079077 2005 Differential gene expression in normal human mammary epithelial cells treated with malathion monitored by DNA microarrays.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14605214 2003 Replication protein A-mediated recruitment and activation of Rad17 complexes.
12930902 2003 The alternative Ctf18-Dcc1-Ctf8-replication factor C complex required for sister chromatid cohesion loads proliferating cell nuclear antigen onto DNA.
12791985 2003 Sensing DNA damage through ATRIP recognition of RPA-ssDNA complexes.
12766176 2003 Cloning and characterization of hCTF18, hCTF8, and hDCC1. Human homologs of a Saccharomyces cerevisiae complex involved in sister chromatid cohesion establishment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12192049 2002 A Mammalian bromodomain protein, brd4, interacts with replication factor C and inhibits progression to S phase.
12171929 2002 A proteomics approach to identify proliferating cell nuclear antigen (PCNA)-binding proteins in human cell lysates. Identification of the human CHL12/RFCs2-5 complex as a novel PCNA-binding protein.
11907025 2002 Structures of the human Rad17-replication factor C and checkpoint Rad 9-1-1 complexes visualized by glycerol spray/low voltage microscopy.
11572977 2001 Purification and characterization of human DNA damage checkpoint Rad complexes.
10884395 2000 The human checkpoint protein hRad17 interacts with the PCNA-like proteins hRad1, hHus1, and hRad9.
10051561 1999 Studies on the interactions between human replication factor C and human proliferating cell nuclear antigen.
9822671 1998 Replication factor C disengages from proliferating cell nuclear antigen (PCNA) upon sliding clamp formation, and PCNA itself tethers DNA polymerase delta to DNA.
9488738 1998 Reconstitution of recombinant human replication factor C (RFC) and identification of an RFC subcomplex possessing DNA-dependent ATPase activity.
9228079 1997 A complex consisting of human replication factor C p40, p37, and p36 subunits is a DNA-dependent ATPase and an intermediate in the assembly of the holoenzyme.
9121429 1997 The human immunodeficiency virus transactivator Tat interacts with the RNA polymerase II holoenzyme.
9111189 1997 Which DNA polymerases are used for DNA-repair in eukaryotes?
9092549 1997 Deletion analysis of the large subunit p140 in human replication factor C reveals regions required for complex formation and replication activities.
8692848 1996 In vitro reconstitution of human replication factor C from its five subunits.
8441605 1993 Homology in accessory proteins of replicative polymerases--E. coli to humans.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7774928 1995 Assignment of the 36.5-kDa (RFC5), 37-kDa (RFC4), 38-kDa (RFC3), and 40-kDa (RFC2) subunit genes of human replication factor C to chromosome bands 12q24.2-q24.3, 3q27, 13q12.3-q13, and 7q11.23.