Property Summary

NCBI Gene PubMed Count 45
PubMed Score 11.07
PubTator Score 5.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 2.80619353333193E-18
glioblastoma 5572 6.36851067194957E-8
malignant mesothelioma 3163 2.2706675108129E-7
atypical teratoid / rhabdoid tumor 4369 7.66344842882805E-7
osteosarcoma 7933 2.68663374279225E-6
nasopharyngeal carcinoma 1056 7.33849599063374E-6
lung cancer 4473 1.97109454194845E-5
group 3 medulloblastoma 2254 2.08859005160713E-5
ovarian cancer 8492 2.55223314104296E-5
medulloblastoma, large-cell 6234 3.03048508698945E-5
psoriasis 6685 5.5190660389347E-5
adrenocortical carcinoma 1427 1.89249713543264E-4
ductal carcinoma in situ 1745 2.37692424700601E-4
primitive neuroectodermal tumor 3031 2.65534780770501E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00344712187086347
ependymoma 2514 0.00403150022525756
chronic lymphocytic leukemia 244 0.006088834132554
Parkinson's disease 364 0.00874012093113765
oligodendroglioma 2849 0.0102728286215723
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0114588675149012
astrocytic glioma 2241 0.0116403320144294
adult high grade glioma 2148 0.0212322220794944
Bipolar Disorder 266 0.0429558476894312
Disease Target Count Z-score Confidence
Ocular melanoma 4 3.449 1.7

Expression

Synonym

Accession P40937 A8MZ62 B3KSX8
Symbols RFC36

Gene

PDB

1LFS  

  Ortholog (13)

 GWAS Trait (1)

Gene RIF (6)

PMID Text
20800603 Observational study of gene-disease association. (HuGE Navigator)
20574454 Observational study of gene-disease association. (HuGE Navigator)
20522537 Observational study of gene-disease association. (HuGE Navigator)
20226869 Observational study of gene-disease association. (HuGE Navigator)
19237606 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
9121429 HIV-1 Tat interacts with the RNA polymerase II holoenzyme, which includes RFC, during Tat-mediated transactivation of the HIV-1 LTR

AA Sequence

METSALKQQEQPAATKIRNLPWVEKYRPQTLNDLISHQDILSTIQKFINEDRLPHLLLYGPPGTGKTSTI      1 - 70
LACAKQLYKDKEFGSMVLELNASDDRGIDIIRGPILSFASTRTIFKKGFKLVILDEADAMTQDAQNALRR     71 - 140
VIEKFTENTRFCLICNYLSKIIPALQSRCTRFRFGPLTPELMVPRLEHVVEEEKVDISEDGMKALVTLSS    141 - 210
GDMRRALNILQSTNMAFGKVTEETVYTCTGHPLKSDIANILDWMLNQDFTTAYRNITELKTLKGLALHDI    211 - 280
LTEIHLFVHRVDFPSSVRIHLLTKMADIEYRLSVGTNEKIQLSSLIAAFQVTRDLIVAEA              281 - 340
//

Text Mined References (49)

PMID Year Title
27703410 2016 Fundamental Characteristics of AAA+ Protein Family Structure and Function.
27664980 2016 Alternative clamp loaders/unloaders.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23688817 2013 New insights into replication clamp unloading.
23684800 2013 DNA repair mechanisms in dividing and non-dividing cells.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22197378 2012 ATP binding and hydrolysis-driven rate-determining events in the RFC-catalyzed PCNA clamp loading reaction.
21269460 2011 Initial characterization of the human central proteome.
More...