Property Summary

NCBI Gene PubMed Count 45
Grant Count 32
R01 Count 22
Funding $5,516,493.17
PubMed Score 11.07
PubTator Score 5.41

Knowledge Summary

Patent

No data available

Expression

 GWAS Trait (1)

Gene RIF (6)

PMID Text
20800603 Observational study of gene-disease association. (HuGE Navigator)
20574454 Observational study of gene-disease association. (HuGE Navigator)
20522537 Observational study of gene-disease association. (HuGE Navigator)
20226869 Observational study of gene-disease association. (HuGE Navigator)
19237606 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
9121429 HIV-1 Tat interacts with the RNA polymerase II holoenzyme, which includes RFC, during Tat-mediated transactivation of the HIV-1 LTR

AA Sequence

METSALKQQEQPAATKIRNLPWVEKYRPQTLNDLISHQDILSTIQKFINEDRLPHLLLYGPPGTGKTSTI      1 - 70
LACAKQLYKDKEFGSMVLELNASDDRGIDIIRGPILSFASTRTIFKKGFKLVILDEADAMTQDAQNALRR     71 - 140
VIEKFTENTRFCLICNYLSKIIPALQSRCTRFRFGPLTPELMVPRLEHVVEEEKVDISEDGMKALVTLSS    141 - 210
GDMRRALNILQSTNMAFGKVTEETVYTCTGHPLKSDIANILDWMLNQDFTTAYRNITELKTLKGLALHDI    211 - 280
LTEIHLFVHRVDFPSSVRIHLLTKMADIEYRLSVGTNEKIQLSSLIAAFQVTRDLIVAEA              281 - 340
//

Text Mined References (49)

PMID Year Title
27703410 2016 Fundamental Characteristics of AAA+ Protein Family Structure and Function.
27664980 2016 Alternative clamp loaders/unloaders.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23688817 2013 New insights into replication clamp unloading.
23684800 2013 DNA repair mechanisms in dividing and non-dividing cells.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22197378 2012 ATP binding and hydrolysis-driven rate-determining events in the RFC-catalyzed PCNA clamp loading reaction.
21269460 2011 Initial characterization of the human central proteome.
More...