Property Summary

NCBI Gene PubMed Count 380
PubMed Score 1317.81
PubTator Score 1041.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
tuberculosis 1.100 1.2e-04
active Crohn's disease 1.406 3.2e-02
active ulcerative colitis 1.165 3.5e-02
adult high grade glioma 1.300 6.3e-03
Astrocytoma, Pilocytic 1.300 2.8e-06
Breast cancer -3.300 2.5e-02
colon cancer -2.100 4.3e-02
cutaneous lupus erythematosus 1.400 3.2e-03
glioblastoma 1.100 9.2e-03
intraductal papillary-mucinous neoplasm ... 1.200 4.5e-02
lung cancer -2.700 5.7e-05
malignant mesothelioma -1.800 2.2e-07
Multiple myeloma 1.109 2.8e-02
nasopharyngeal carcinoma 1.300 2.8e-03
non-small cell lung cancer -1.192 5.0e-08
osteosarcoma -1.710 9.0e-03
ovarian cancer -2.500 1.6e-07
posterior fossa group A ependymoma 1.200 2.6e-04
sarcoidosis 1.200 2.1e-02
urothelial carcinoma -1.100 1.6e-02

 IMPC Phenotype (2)

Protein-protein Interaction (7)

Gene RIF (369)

AA Sequence

MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHID      1 - 70
ATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELE     71 - 140
EKNIKEFLQSFVHIVQMFINTS                                                    141 - 162
//

Text Mined References (381)

PMID Year Title