Property Summary

NCBI Gene PubMed Count 353
Grant Count 1,000
R01 Count 523
Funding $137,158,463.9
PubMed Score 1248.23
PubTator Score 1041.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
Multiple myeloma 1.109 0.028
urothelial carcinoma -1.100 0.016
malignant mesothelioma -1.900 0.000
cutaneous lupus erythematosus 1.400 0.003
osteosarcoma -1.710 0.009
glioblastoma 1.100 0.009
tuberculosis 1.100 0.000
non-small cell lung cancer -1.192 0.000
intraductal papillary-mucinous neoplasm ... 1.200 0.045
colon cancer -2.100 0.043
lung cancer -2.700 0.000
active Crohn's disease 1.406 0.032
active ulcerative colitis 1.165 0.035
sarcoidosis 1.200 0.021
Breast cancer -3.300 0.025
adult high grade glioma 1.300 0.006
pilocytic astrocytoma 1.300 0.000
posterior fossa group A ependymoma 1.200 0.000
nasopharyngeal carcinoma 1.300 0.003
ovarian cancer -2.500 0.000

Synonym

Gene

PDB

4GS7   2XQB   2Z3Q   2Z3R  

 GO Function (1)

 IMPC Term (1)

Gene RIF (344)

PMID Text
27129235 Culturing NK cells under hypoxia compared with ambient air (normoxia) and IL-15 priming synergistically augmented glycolytic gene expression without major changes in glycolytic flux and glucose consumption.
27097762 Virtual memory T cells develop and mediate bystander protective immunity in an IL-15-dependent manner.
26719339 The novel mechanism of IL-15 transfer to the surface of antigen-processing DCs may explain the enhanced potency of IL-15:IL-15Ralpha-coated nanoparticles for antigen delivery.
26675759 Report improved antitumoral NK-cell activity in DC-based vaccine strategies through the use of IL-15/IL-15Ralpha mRNA-engineered designer DC.
26625316 Findings suggest for co-targeting shedding-derived soluble MIC (sMIC) to enhance the therapeutic efficacy of ALT-803 or other interleukin 15 (IL-15) agonists.
26567920 Studeis indicate that expression of interleukin-15 (IL-15) in tissues promotes T helper 1 cell-mediated immunity.
26481260 results demonstrated the relative functional deficiencies of alpha-GalCer induced UCB iNKT cells, which can be ameliorated by IL-15
26479922 IL15 was expressed primarily in the suprabulb of the hair follicle.
26464654 Protein, mRNA, and serum expression levels of MMP-7 and IL-15 in patients with osteoarthritis were all significantly increased in osteoarthritis patients compared with the control group.
26453750 These findings demonstrate a novel mechanism to attenuate IL-15-dependent NK cell proliferation and suggest that inhibitory NK cell receptors contribute to NK cell homeostasis.
More...

AA Sequence

MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHID      1 - 70
ATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELE     71 - 140
EKNIKEFLQSFVHIVQMFINTS                                                    141 - 162
//

Text Mined References (354)

PMID Year Title
27129235 2016 Short Term Hypoxia Synergizes with Interleukin 15 Priming in Driving Glycolytic Gene Transcription and Supports Human Natural Killer Cell Activities.
27097762 2016 Virtual memory T cells develop and mediate bystander protective immunity in an IL-15-dependent manner.
26719339 2016 Configuration-dependent Presentation of Multivalent IL-15:IL-15R? Enhances the Antigen-specific T Cell Response and Anti-tumor Immunity.
26675759 2015 Transpresentation of interleukin-15 by IL-15/IL-15R? mRNA-engineered human dendritic cells boosts antitumoral natural killer cell activity.
26625316 2016 Cooperative therapeutic anti-tumor effect of IL-15 agonist ALT-803 and co-targeting soluble NKG2D ligand sMIC.
26567920 2015 IL-15 functions as a danger signal to regulate tissue-resident T cells and tissue destruction.
26481260 2015 Interleukin-15 enhances the expansion and function of natural killer T cells from adult peripheral and umbilical cord blood.
26479922 2015 Hair follicle-derived IL-7 and IL-15 mediate skin-resident memory T cell homeostasis and lymphoma.
26464654 2015 Expression and correlation of matrix metalloproteinase-7 and interleukin-15 in human osteoarthritis.
26453750 2015 NK Cell Proliferation Induced by IL-15 Transpresentation Is Negatively Regulated by Inhibitory Receptors.
More...