Property Summary

Ligand Count 1
NCBI Gene PubMed Count 41
PubMed Score 186.08
PubTator Score 86.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -1.400 1.1e-02
atypical teratoid / rhabdoid tumor -1.200 5.4e-05
Breast cancer 2.600 2.5e-02
ependymoma -1.300 3.8e-02
glioblastoma 1.300 2.9e-02
lung cancer 1.300 9.5e-04
medulloblastoma -1.100 3.6e-05
Multiple myeloma 1.000 4.1e-03
oligodendroglioma -1.100 3.9e-02
ovarian cancer 2.700 3.6e-06
pancreatic ductal adenocarcinoma liver m... -1.693 3.2e-02
Pick disease -1.100 2.7e-03
psoriasis 1.100 4.7e-04

 GWAS Trait (1)

Gene RIF (8)

AA Sequence

MLSALARPASAALRRSFSTSAQNNAKVAVLGASGGIGQPLSLLLKNSPLVSRLTLYDIAHTPGVAADLSH      1 - 70
IETKAAVKGYLGPEQLPDCLKGCDVVVIPAGVPRKPGMTRDDLFNTNATIVATLTAACAQHCPEAMICVI     71 - 140
ANPVNSTIPITAEVFKKHGVYNPNKIFGVTTLDIVRANTFVAELKGLDPARVNVPVIGGHAGKTIIPLIS    141 - 210
QCTPKVDFPQDQLTALTGRIQEAGTEVVKAKAGAGSATLSMAYAGARFVFSLVDAMNGKEGVVECSFVKS    211 - 280
QETECTYFSTPLLLGKKGIEKNLGIGKVSSFEEKMISDAIPELKASIKKGEDFVKTLK                281 - 338
//

Text Mined References (48)

PMID Year Title