Property Summary

NCBI Gene PubMed Count 40
PubMed Score 180.24
PubTator Score 86.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
ovarian cancer 8492 3.57649350210177E-6
medulloblastoma 1524 3.59233225554619E-5
atypical teratoid / rhabdoid tumor 4369 5.37358429361194E-5
lung cancer 4473 9.66901490815993E-5
psoriasis 6685 4.71031855925237E-4
Pick disease 1893 0.00271234276053954
Multiple myeloma 1328 0.00409560414478717
astrocytic glioma 2241 0.0110534822323299
Breast cancer 3099 0.0248609387717636
glioblastoma 5572 0.0289524057999366
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0323770406170991
ependymoma 2514 0.0378582257459961
oligodendroglioma 2849 0.0394146269828391

Expression

  Differential Expression (13)

Disease log2 FC p
Multiple myeloma 1.000 0.004
astrocytic glioma -1.400 0.011
ependymoma -1.300 0.038
oligodendroglioma -1.100 0.039
psoriasis 1.100 0.000
glioblastoma 1.300 0.029
atypical teratoid / rhabdoid tumor -1.200 0.000
medulloblastoma -1.100 0.000
pancreatic ductal adenocarcinoma liver m... -1.693 0.032
lung cancer 1.600 0.000
Breast cancer 2.600 0.025
Pick disease -1.100 0.003
ovarian cancer 2.700 0.000

Synonym

Accession P40926 A8K414 B2RE78 B4DE44 E9PDB2 O43682
Symbols MDH
MOR1
M-MDH
MGC:3559

Gene

PANTHER Protein Class (2)

PDB

2DFD   4WLE   4WLF   4WLN   4WLO   4WLU   4WLV  

  Ortholog (15)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA Inparanoid
Fruitfly EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (7)

PMID Text
25766404 Segregation of the mutation with disease and absence of MDH2 in mutated tumors revealed MDH2 as a novel pheochromocytoma/paraganglioma susceptibility gene.
25639359 Data indicate that acetyl-CoA acetyltransferase (ACAT1) and malate dehydrogenase (MDH2) are involved in various drug-resistance-forming mechanisms.
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of malate dehydrogenase 2 (MDH2) expression by HIV-1 Vpr in Vpr transduced macrophages
22944692 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of malate dehydrogenase 2 (MDH2) expression by HIV-1 Vpr in Vpr transduced macrophages
20877624 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17603759 L-2-hydroxyglutarate accumulates as a result of a deficiency in FAD-linked L-2-hydroxyglutarate dehydrogenase. mitochondrial L-malate dehydrogenase is responsible for the excretion of L-2-hydroxyglutarate in this condition.

AA Sequence

MLSALARPASAALRRSFSTSAQNNAKVAVLGASGGIGQPLSLLLKNSPLVSRLTLYDIAHTPGVAADLSH      1 - 70
IETKAAVKGYLGPEQLPDCLKGCDVVVIPAGVPRKPGMTRDDLFNTNATIVATLTAACAQHCPEAMICVI     71 - 140
ANPVNSTIPITAEVFKKHGVYNPNKIFGVTTLDIVRANTFVAELKGLDPARVNVPVIGGHAGKTIIPLIS    141 - 210
QCTPKVDFPQDQLTALTGRIQEAGTEVVKAKAGAGSATLSMAYAGARFVFSLVDAMNGKEGVVECSFVKS    211 - 280
QETECTYFSTPLLLGKKGIEKNLGIGKVSSFEEKMISDAIPELKASIKKGEDFVKTLK                281 - 338
//

Text Mined References (47)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25766404 2015 Whole-exome sequencing identifies MDH2 as a new familial paraganglioma gene.
25639359 2015 Mitochondrial proteomics with siRNA knockdown to reveal ACAT1 and MDH2 in the development of doxorubicin-resistant uterine cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21908771 2011 The first identification of lysine malonylation substrates and its regulatory enzyme.
More...