Property Summary

NCBI Gene PubMed Count 31
PubMed Score 409.59
PubTator Score 108.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
medulloblastoma 1524 1.75019070641003E-8
atypical teratoid / rhabdoid tumor 4369 3.23869224362469E-8
pilocytic astrocytoma 3086 7.55456502197086E-7
ovarian cancer 8492 2.62381634738676E-6
adrenocortical carcinoma 1427 6.1924857466174E-6
adult high grade glioma 2148 6.91138704889188E-6
glioblastoma 5572 9.92105506872427E-6
psoriasis 6685 4.84339351681464E-5
primitive neuroectodermal tumor 3031 9.35200840029276E-5
medulloblastoma, large-cell 6234 1.69656132681224E-4
Multiple myeloma 1328 6.4537246784778E-4
Pick disease 1893 7.4813727860443E-4
osteosarcoma 7933 7.94009204165282E-4
astrocytic glioma 2241 0.00177437560741615
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00194248790584146
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00246376168213388
ependymoma 2514 0.00433334315515527
Waldenstrons macroglobulinemia 765 0.00903751849131901
oligodendroglioma 2849 0.0197561175004319
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0229219600701006
Breast cancer 3099 0.0280468531488129
Alzheimer's disease 644 0.0402294985705797
Parkinson's disease 364 0.0464955464934209

Expression

  Differential Expression (23)

Synonym

Accession P40925 B2R5V5 B4DUN2 B7Z3I7 F5H098 Q6I9V0
Symbols MDHA
MOR2
MDH-s
HEL-S-32
MGC:1375

Gene

PANTHER Protein Class (2)

  Ortholog (14)

Gene RIF (9)

PMID Text
22693256 adipogenic differentiation may be regulated by the acetylation of MDH1
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20602615 Observational study of gene-disease association. (HuGE Navigator)
20011630 The MDH1 gene is not the cause of RP28-linked autosomal recessive retinitis pigmentosa.
19229245 Malate Dehydrogenase directly regulates the Tumor Suppressor Protein p53-dependent apoptosis upon glucose deprivation and involved in maintaining cellular metabolic state and further determining cell death.
19110265 This protein has been found differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.
18996102 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15565635 expression of MDH1 is maintained in the adult heart but is not present in levels as high as in the fetus

AA Sequence

MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIA      1 - 70
TDKEDVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAALDKYAKKSVKVIVVGNPANTNCLTA     71 - 140
SKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKVKLQGKEVGVY    141 - 210
EALKDDSWLKGEFVTTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGVISDGNSYGV    211 - 280
PDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKESAFEFLSSA                    281 - 334
//

Text Mined References (39)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25340584 2014 Ribosomal readthrough at a short UGA stop codon context triggers dual localization of metabolic enzymes in Fungi and animals.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22905912 2012 Resveratrol-induced changes of the human adipocyte secretion profile.
22693256 2012 Acetylation of malate dehydrogenase 1 promotes adipogenic differentiation via activating its enzymatic activity.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
22360420 2012 Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
More...