Property Summary

NCBI Gene PubMed Count 34
PubMed Score 428.30
PubTator Score 108.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (23)

Disease log2 FC p
adrenocortical carcinoma 1.436 6.2e-06
adult high grade glioma -1.600 6.9e-06
Alzheimer's disease -1.300 4.0e-02
astrocytic glioma -2.000 1.8e-03
Astrocytoma, Pilocytic -1.100 7.9e-07
atypical teratoid / rhabdoid tumor -1.600 3.2e-08
Breast cancer 2.400 2.8e-02
ependymoma -1.800 4.3e-03
glioblastoma -1.100 4.4e-08
group 3 medulloblastoma -1.100 3.4e-03
intraductal papillary-mucinous adenoma (... 1.200 1.9e-03
intraductal papillary-mucinous carcinoma... 1.200 2.5e-03
medulloblastoma, large-cell -1.200 1.7e-04
Multiple myeloma 1.637 6.5e-04
oligodendroglioma -1.500 2.0e-02
osteosarcoma 1.389 7.9e-04
ovarian cancer -2.000 1.9e-06
pancreatic ductal adenocarcinoma liver m... 1.135 3.2e-03
Parkinson's disease -1.300 4.6e-02
Pick disease -1.900 7.5e-04
primitive neuroectodermal tumor -1.200 9.4e-05
psoriasis 1.600 4.8e-05
Waldenstrons macroglobulinemia 1.161 9.0e-03

Gene RIF (12)

AA Sequence

MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIA      1 - 70
TDKEDVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAALDKYAKKSVKVIVVGNPANTNCLTA     71 - 140
SKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKVKLQGKEVGVY    141 - 210
EALKDDSWLKGEFVTTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGVISDGNSYGV    211 - 280
PDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKESAFEFLSSA                    281 - 334
//

Text Mined References (42)

PMID Year Title