Property Summary

NCBI Gene PubMed Count 47
Grant Count 157
R01 Count 98
Funding $14,923,619.13
PubMed Score 656.24
PubTator Score 298.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
ulcerative colitis -1.500 0.000
colon cancer -4.300 0.000
Breast cancer -1.800 0.002
psoriasis -3.900 0.000

Synonym

Accession P40879
Symbols CLD
DRA

Gene

PANTHER Protein Class (1)

 GWAS Trait (1)

Gene RIF (31)

PMID Text
25143346 Data demonstrate an upregulation of SLC26A3 via activation of the ERK1/2 pathway that may underlie potential antidiarrheal effects of Bifidobacterium sp.
25059823 Efficacy of lactobacillus acidophilus or its secreted soluble factors in alleviating inflammation and inflammation-associated dysregulation of DRA activity could justify their therapeutic potential in inflammatory diarrheal diseases.
23756661 few patients develop illnesses because of SLC26A3 mutations.
23660504 Slc26a3 contributes to sulfate secretion via DIDS-senstive bicarbonate-sulfate exchange in addition to being the principal DIDS-resistant chloride-bicarbonate exchanger.
23274434 This is the first report to demonstrate the genetic background of congenital chloride diarrhea in a single ethnic group of East Asian descent (Korean). The c.2063-1G>T mutation wa found in at least one allele of all patients.
22627094 The SLC26A3-NHERF4 interaction was modulated by phosphorylation; serine 329 of NHERF4-PDZ3 played a critical role in modulating binding selectivity.
22159084 these data indicate that N-glycosylation of SLC26A3 is important for cell surface expression and for protection from proteolytic degradation that may contribute to the understanding of pathogenesis of congenital disorders of glycosylation.
21694535 Data from pediatric patients with congenital chloride diarrhea identifies 7 novel mutations in SLC26A3, including 3 missense changes of highly conserved residues.
21394828 This review summarizes the current knowledge of SLC26A3 mutations and polymorphisms in congenital chloride diarrhea. [Review]
21150650 study describes 2 novel mutations in 2 siblings with congenital chloride diarrhea (CLD)from Andalusia; show the presence of compound heterozygous mutations as the cause of CLD in this family
More...

AA Sequence

MIEPFGNQYIVARPVYSTNAFEENHKKTGRHHKTFLDHLKVCCSCSPQKAKRIVLSLFPIASWLPAYRLK      1 - 70
EWLLSDIVSGISTGIVAVLQGLAFALLVDIPPVYGLYASFFPAIIYLFFGTSRHISVGPFPILSMMVGLA     71 - 140
VSGAVSKAVPDRNATTLGLPNNSNNSSLLDDERVRVAAAASVTVLSGIIQLAFGILRIGFVVIYLSESLI    141 - 210
SGFTTAAAVHVLVSQLKFIFQLTVPSHTDPVSIFKVLYSVFSQIEKTNIADLVTALIVLLVVSIVKEINQ    211 - 280
RFKDKLPVPIPIEFIMTVIAAGVSYGCDFKNRFKVAVVGDMNPGFQPPITPDVETFQNTVGDCFGIAMVA    281 - 350
FAVAFSVASVYSLKYDYPLDGNQELIALGLGNIVCGVFRGFAGSTALSRSAVQESTGGKTQIAGLIGAII    351 - 420
VLIVVLAIGFLLAPLQKSVLAALALGNLKGMLMQFAEIGRLWRKDKYDCLIWIMTFIFTIVLGLGLGLAA    421 - 490
SVAFQLLTIVFRTQFPKCSTLANIGRTNIYKNKKDYYDMYEPEGVKIFRCPSPIYFANIGFFRRKLIDAV    491 - 560
GFSPLRILRKRNKALRKIRKLQKQGLLQVTPKGFICTVDTIKDSDEELDNNQIEVLDQPINTTDLPFHID    561 - 630
WNDDLPLNIEVPKISLHSLILDFSAVSFLDVSSVRGLKSILQEFIRIKVDVYIVGTDDDFIEKLNRYEFF    631 - 700
DGEVKSSIFFLTIHDAVLHILMKKDYSTSKFNPSQEKDGKIDFTINTNGGLRNRVYEVPVETKF          701 - 764
//

Text Mined References (49)

PMID Year Title
25143346 2014 Probiotic Bifidobacterium species stimulate human SLC26A3 gene function and expression in intestinal epithelial cells.
25059823 2014 Lactobacillus acidophilus attenuates downregulation of DRA function and expression in inflammatory models.
24647542 2014 N-glycosylation and topology of the human SLC26 family of anion transport membrane proteins.
23756661 2013 SLC26A3 gene analysis in patients with Bartter and Gitelman syndromes and the clinical characteristics of patients with unidentified mutations.
23660504 2013 Sulfate secretion and chloride absorption are mediated by the anion exchanger DRA (Slc26a3) in the mouse cecum.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23274434 2013 Congenital chloride diarrhea in Korean children: novel mutations and genetic characteristics.
22627094 2012 Regulation of SLC26A3 activity by NHERF4 PDZ-mediated interaction.
22159084 2012 Role of N-glycosylation in cell surface expression and protection against proteolysis of the intestinal anion exchanger SLC26A3.
21694535 2011 Significance of molecular testing for congenital chloride diarrhea.
More...