Property Summary

NCBI Gene PubMed Count 64
Grant Count 21
R01 Count 16
Funding $2,304,703.11
PubMed Score 52.94
PubTator Score 37.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
tuberculosis and treatment for 6 months 1.100 0.000
diabetes mellitus -1.200 0.002
ovarian cancer -1.200 0.000

Gene RIF (35)

PMID Text
26701869 No somatic mutations were observed in USP8 in a cohort of GH-secreting pituitary adenomas.
26683461 Results show that in addition to the scaffolding function in complex formation, BRUCE has an E3 ligase function to promote BRIT1 deubiquitination by USP8 leading to accumulation of BRIT1 at DNA double-strand break.
26578638 The presence of USP8 mutations may predict favorable responses to the somatostatin analog pasireotide in corticotroph adenomas of Cushing's disease.
26571504 Ubpy loss of function results in the accumulation of autophagosomes due to a blockade of the autophagy flux.
26459808 USP8 regulates VEGFR2 trafficking, signaling and proteolysis.
26285834 Studies indicate that ubiquitin specific protease 8 protein (USP8) mutations contribute to adrenocorticotropic hormone (ACTH) overproduction in Cushing's disease (CD).
25942478 USP8 is frequently mutated in adenomas causing Cushing's disease, especially in those from female adult patients diagnosed at a younger age.
25930709 The identification of USP8 mutations as contributors to the pathogenesis of ACTH-secreting pituitary adenomas represents an exciting advance in our understanding of Cushing's disease and its potential treatment into the of precision medicine.
25863102 Haplotype CAAG may be a down-regulating factor for the risk of non-obstructive azoospermia.
25733871 BRUCE acts as a scaffold, bridging the ubiquitin-specific peptidase 8 (USP8) and BRIT1 in a complex to coordinate USP8-catalyzed deubiquitination of BRIT1.
More...

AA Sequence

MPAVASVPKELYLSSSLKDLNKKTEVKPEKISTKSYVHSALKIFKTAEECRLDRDEERAYVLYMKYVTVY      1 - 70
NLIKKRPDFKQQQDYFHSILGPGNIKKAVEEAERLSESLKLRYEEAEVRKKLEEKDRQEEAQRLQQKRQE     71 - 140
TGREDGGTLAKGSLENVLDSKDKTQKSNGEKNEKCETKEKGAITAKELYTMMTDKNISLIIMDARRMQDY    141 - 210
QDSCILHSLSVPEEAISPGVTASWIEAHLPDDSKDTWKKRGNVEYVVLLDWFSSAKDLQIGTTLRSLKDA    211 - 280
LFKWESKTVLRNEPLVLEGGYENWLLCYPQYTTNAKVTPPPRRQNEEVSISLDFTYPSLEESIPSKPAAQ    281 - 350
TPPASIEVDENIELISGQNERMGPLNISTPVEPVAASKSDVSPIIQPVPSIKNVPQIDRTKKPAVKLPEE    351 - 420
HRIKSESTNHEQQSPQSGKVIPDRSTKPVVFSPTLMLTDEEKARIHAETALLMEKNKQEKELRERQQEEQ    421 - 490
KEKLRKEEQEQKAKKKQEAEENEITEKQQKAKEEMEKKESEQAKKEDKETSAKRGKEITGVKRQSKSEHE    491 - 560
TSDAKKSVEDRGKRCPTPEIQKKSTGDVPHTSVTGDSGSGKPFKIKGQPESGILRTGTFREDTDDTERNK    561 - 630
AQREPLTRARSEEMGRIVPGLPSGWAKFLDPITGTFRYYHSPTNTVHMYPPEMAPSSAPPSTPPTHKAKP    631 - 700
QIPAERDREPSKLKRSYSSPDITQAIQEEEKRKPTVTPTVNRENKPTCYPKAEISRLSASQIRNLNPVFG    701 - 770
GSGPALTGLRNLGNTCYMNSILQCLCNAPHLADYFNRNCYQDDINRSNLLGHKGEVAEEFGIIMKALWTG    771 - 840
QYRYISPKDFKITIGKINDQFAGYSQQDSQELLLFLMDGLHEDLNKADNRKRYKEENNDHLDDFKAAEHA    841 - 910
WQKHKQLNESIIVALFQGQFKSTVQCLTCHKKSRTFEAFMYLSLPLASTSKCTLQDCLRLFSKEEKLTDN    911 - 980
NRFYCSHCRARRDSLKKIEIWKLPPVLLVHLKRFSYDGRWKQKLQTSVDFPLENLDLSQYVIGPKNNLKK    981 - 1050
YNLFSVSNHYGGLDGGHYTAYCKNAARQRWFKFDDHEVSDISVSSVKSSAAYILFYTSLGPRVTDVAT     1051 - 1118
//

Text Mined References (76)

PMID Year Title
26701869 2016 Landscape of somatic mutations in sporadic GH-secreting pituitary adenomas.
26683461 2015 The UBC Domain Is Required for BRUCE to Promote BRIT1/MCPH1 Function in DSB Signaling and Repair Post Formation of BRUCE-USP8-BRIT1 Complex.
26578638 2016 The USP8 mutational status may predict drug susceptibility in corticotroph adenomas of Cushing's disease.
26571504 2015 The Deubiquitinating Enzyme UBPY Is Required for Lysosomal Biogenesis and Productive Autophagy in Drosophila.
26459808 2016 VEGFR2 Trafficking, Signaling and Proteolysis is Regulated by the Ubiquitin Isopeptidase USP8.
26285834 2015 USP8 mutation in Cushing's disease.
25942478 2015 The Gene of the Ubiquitin-Specific Protease 8 Is Frequently Mutated in Adenomas Causing Cushing's Disease.
25930709 2015 Cushing's disease: towards precision medicine.
25863102 2015 [Study on the association of USP8 gene polymorphisms with male infertility in ethnic Han Chinese from Sichuan].
25733871 2015 BRUCE regulates DNA double-strand break response by promoting USP8 deubiquitination of BRIT1.
More...