Property Summary

NCBI Gene PubMed Count 851
PubMed Score 2352.58
PubTator Score 1976.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count
Sebaceous adenoma 26
Abdominal Pain 98
Abnormality of the abdomen 14
Adenocarcinoma of duodenum 2
Anxiety 136
Anxiety disease 113
Attention deficit hyperactivity disorder 278
Autosomal recessive predisposition 1442
Axillary freckling 5
Basal cell carcinoma 54
Basal cell nevi 23
Benign digestive system neoplasms 2
Benign genitourinary tract neoplasm 2
Birthmark 35
Cafe au lait spots, multiple 17
Cafe-au-Lait Spots 37
Carcinoma of larynx 2
Colon diverticulum anatomic structure 15
Colorectal cancer 25
Constipation 181
Death in early adulthood 24
Death in early childhood 82
Death in infancy 82
Depressive disorder 409
Diverticular disease of colon 15
Duodenal Cancer 2
Dyschezia 135
Epilepsy 792
Fatigue 182
Fibrous skin tumor of tuberous sclerosis 18
Gastrointestinal Hemorrhage 52
Hematologic Neoplasms 22
Hereditary Non-Polyposis Colon Cancer Type 2 1
Hereditary Nonpolyposis Colorectal Cancer 11
Hereditary Nonpolyposis Colorectal Neoplasms 8
Hyperpigmented macules 42
Increased gastric cancer 21
Intermittent migraine headaches 68
Intracranial hypertension 32
Irritation - emotion 68
Leukemia 104
Malabsorption 82
Malignant genitourinary tract tumors 2
Malignant tumor of colon 19
Migraine Disorders 76
Muscle Hypertonia 88
Muscle hypotonia 571
Nausea and vomiting 97
Neuroblastoma 80
Rectal Neoplasms 18
Rhabdomyosarcoma 39
Sebaceous Adenocarcinoma 2
Seizures 596
Stomach Neoplasms 300
Torre-Muir syndrome 3
Turcot syndrome (disorder) 5
Weight decreased 103
breast carcinoma 1638
ependymoma 4679
glioblastoma 5792
medulloblastoma 720
ovarian neoplasm 99
Disease Target Count P-value
psoriasis 6694 5.0e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.3
Kidney cancer 2613 0.0 1.1

Expression

  Differential Expression (2)

Disease log2 FC p
ovarian cancer -1.500 4.6e-09
psoriasis 2.000 5.0e-05

 IMPC Phenotype (2)

Protein-protein Interaction (9)

Gene RIF (795)

AA Sequence

MSFVAGVIRRLDETVVNRIAAGEVIQRPANAIKEMIENCLDAKSTSIQVIVKEGGLKLIQIQDNGTGIRK      1 - 70
EDLDIVCERFTTSKLQSFEDLASISTYGFRGEALASISHVAHVTITTKTADGKCAYRASYSDGKLKAPPK     71 - 140
PCAGNQGTQITVEDLFYNIATRRKALKNPSEEYGKILEVVGRYSVHNAGISFSVKKQGETVADVRTLPNA    141 - 210
STVDNIRSIFGNAVSRELIEIGCEDKTLAFKMNGYISNANYSVKKCIFLLFINHRLVESTSLRKAIETVY    211 - 280
AAYLPKNTHPFLYLSLEISPQNVDVNVHPTKHEVHFLHEESILERVQQHIESKLLGSNSSRMYFTQTLLP    281 - 350
GLAGPSGEMVKSTTSLTSSSTSGSSDKVYAHQMVRTDSREQKLDAFLQPLSKPLSSQPQAIVTEDKTDIS    351 - 420
SGRARQQDEEMLELPAPAEVAAKNQSLEGDTTKGTSEMSEKRGPTSSNPRKRHREDSDVEMVEDDSRKEM    421 - 490
TAACTPRRRIINLTSVLSLQEEINEQGHEVLREMLHNHSFVGCVNPQWALAQHQTKLYLLNTTKLSEELF    491 - 560
YQILIYDFANFGVLRLSEPAPLFDLAMLALDSPESGWTEEDGPKEGLAEYIVEFLKKKAEMLADYFSLEI    561 - 630
DEEGNLIGLPLLIDNYVPPLEGLPIFILRLATEVNWDEEKECFESLSKECAMFYSIRKQYISEESTLSGQ    631 - 700
QSEVPGSIPNSWKWTVEHIVYKALRSHILPPKHFTEDGNILQLANLPDLYKVFERC                  701 - 756
//

Text Mined References (886)

PMID Year Title