Property Summary

NCBI Gene PubMed Count 12
PubMed Score 7.85
PubTator Score 5.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
Breast cancer 3578 7.5e-06

Expression

  Differential Expression (1)

Disease log2 FC p
Breast cancer -1.900 7.5e-06

Gene RIF (4)

AA Sequence

MGNGLSDQTSILSNLPSFQSFHIVILGLDCAGKTTVLYRLQFNEFVNTVPTKGFNTEKIKVTLGNSKTVT      1 - 70
FHFWDVGGQEKLRPLWKSYTRCTDGIVFVVDSVDVERMEEAKTELHKITRISENQGVPVLIVANKQDLRN     71 - 140
SLSLSEIEKLLAMGELSSSTPWHLQPTCAIIGDGLKEGLEKLHDMIIKRRKMLRQQKKKR              141 - 200
//

Text Mined References (14)

PMID Year Title