Property Summary

NCBI Gene PubMed Count 27
Grant Count 14
R01 Count 4
Funding $591,429.26
PubMed Score 3.58
PubTator Score 27.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.200 0.021
osteosarcoma 1.156 0.034
glioblastoma 1.100 0.007
medulloblastoma -1.100 0.000
medulloblastoma, large-cell -1.600 0.001
hereditary spastic paraplegia -1.090 0.007
pancreatic ductal adenocarcinoma liver m... -1.339 0.014
active Crohn's disease 1.369 0.011
invasive ductal carcinoma 1.100 0.001
ovarian cancer 2.400 0.000
dermatomyositis 1.100 0.000

Gene RIF (12)

PMID Text
24835460 Together the findings indicate that Arl1 links Rab4-dependent formation of endosomal sorting domains with downstream assembly of adaptor protein complexes that constitute the endosomal sorting machinery.
23345439 results demonstrate that activated Arl1p can promote the spatial modulation of membrane organization at the trans-Golgi network through interacting with the effectors Gea2p and Drs2p
23125841 Tandem affinity purification and mass spectrometry analysis identify ADP-ribosylation factor-like 1 (ARL1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify ADP-ribosylation factor-like 1 (ARL1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify ADP-ribosylation factor-like 1 (ARL1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify ADP-ribosylation factor-like 1 (ARL1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22679020 The Arl1.Arfaptin-2 BAR structure suggests that one of the two Arl1 molecules competes with Rac1, which binds to the concave face of the Arfaptin-2 BAR homodimer and may hinder its membrane association.
21239483 arfaptins are recruited onto trans-Golgi membranes by interacting with Arl1, and capable of inducing membrane deformation via their BAR domains.
19703403 Study demonstrates that Golgi recruitment of endogenous GCC185 does not involve Rab6A/A' and Arl1.
19224922 Results show that ARL1 and ARFRP1 regulate retrograde transport of Shiga toxin to the TGN and anterograde transport of VSVG from the TGN, respectively.
More...

AA Sequence

MGGFFSSIFSSLFGTREMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVETVTYKNLKFQVWDLGG      1 - 70
QTSIRPYWRCYYSNTDAVIYVVDSCDRDRIGISKSELVAMLEEEELRKAILVVFANKQDMEQAMTSSEMA     71 - 140
NSLGLPALKDRKWQIFKTSATKGTGLDEAMEWLVETLKSRQ                                 141 - 181
//

Text Mined References (32)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
24835460 2014 Rab4 orchestrates a small GTPase cascade for recruitment of adaptor proteins to early endosomes.
24709693 2014 Genome-wide data reveal novel genes for methotrexate response in a large cohort of juvenile idiopathic arthritis cases.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23345439 2013 Arl1p regulates spatial membrane organization at the trans-Golgi network through interaction with Arf-GEF Gea2p and flippase Drs2p.
22679020 2012 Structural basis for membrane binding specificity of the Bin/Amphiphysin/Rvs (BAR) domain of Arfaptin-2 determined by Arl1 GTPase.
21269460 2011 Initial characterization of the human central proteome.
21239483 2011 Arfaptins are localized to the trans-Golgi by interaction with Arl1, but not Arfs.
19703403 2009 The localization of the Golgin GCC185 is independent of Rab6A/A' and Arl1.
More...