Property Summary

NCBI Gene PubMed Count 36
PubMed Score 63.24
PubTator Score 28.70

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P40429 A8K505
Symbols L13A
TSTA1

Gene

PDB

4UG0   4V6X   5AJ0  

Gene RIF (9)

PMID Text
23689135 This work identified the arginine residue at position 68 of L13A as being essential for L13A binding to rRNA and incorporation into ribosomes.
22771119 GAPDH functions as a chaperone, shielding newly released RPL13a from proteasomal degradation.
22533734 Ribosomal protein l13a is a reference gene for human bone marrow-derived mesenchymal stromal cells during expansion, adipo-, chondro-, and osteogenesis
21114473 The study found two ribosomal proteins, RPS7 and RPL13A that interact with the HMG (high-mobility group) box domain of SRY.
20716364 Data show that EF1alpha, RPL13a and YWHAZ are suitable genes for the RT-qPCR analysis and comparison of several sources of human MSC during in vitro characterization and differentiation as well as in an ex vivo animal model of global cerebral ischemia.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
17921318 L13a may have evolved from an essential ribosomal protein in lower eukaryotes to having a role as a dispensable extra-ribosomal function in higher eukaryotes.
14567916 A translational silencing mechanism involving regulated release of RPL13a and subsequent binding to its target mRNA was elucidated.

AA Sequence

MAEVQVLVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNPSRGP      1 - 70
YHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKVVRLKPTRKFAYLGR     71 - 140
LAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVEKKIDKYTEVLKTHGLLV           141 - 203
//

Text Mined References (43)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23689135 2013 Insights into the mechanism of ribosomal incorporation of mammalian L13a protein during ribosome biogenesis.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
23071094 2012 Heterotrimeric GAIT complex drives transcript-selective translation inhibition in murine macrophages.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22771119 2012 Protection of extraribosomal RPL13a by GAPDH and dysregulation by S-nitrosylation.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22533734 2012 Ribosomal protein l13a as a reference gene for human bone marrow-derived mesenchymal stromal cells during expansion, adipo-, chondro-, and osteogenesis.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21630459 2011 Proteomic characterization of the human sperm nucleus.
More...