Property Summary

NCBI Gene PubMed Count 37
PubMed Score 36.02
PubTator Score 20.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adrenocortical carcinoma -1.005 1.2e-02
astrocytoma 2.300 5.5e-03
Astrocytoma, Pilocytic 1.600 3.4e-05
atypical teratoid / rhabdoid tumor 1.700 4.9e-04
Chronic Lymphocytic Leukemia 1.290 2.2e-03
colon cancer -1.800 2.3e-05
ependymoma 1.700 8.1e-09
glioblastoma 1.900 3.3e-03
group 4 medulloblastoma -1.800 8.0e-04
intraductal papillary-mucinous adenoma (... -1.500 7.1e-03
invasive ductal carcinoma 1.135 1.4e-03
lung cancer -2.300 7.2e-03
lung carcinoma 1.700 1.4e-33
medulloblastoma, large-cell 1.200 3.2e-02
ovarian cancer -2.900 3.5e-12
pediatric high grade glioma 1.400 6.9e-04
pituitary cancer 1.400 1.7e-05
primitive neuroectodermal tumor 2.200 1.2e-02

Gene RIF (22)

AA Sequence

MDDQSRMLQTLAGVNLAGHSVQGGMALPPPPHGHEGADGDGRKQDIGDILHQIMTITDQSLDEAQAKKHA      1 - 70
LNCHRMKPALFSVLCEIKEKTGLSIRGAQEEDPPDPQLMRLDNMLLAEGVSGPEKGGGSAAAAAAAAASG     71 - 140
GSSDNSIEHSDYRAKLTQIRQIYHTELEKYEQACNEFTTHVMNLLREQSRTRPISPKEIERMVGIIHRKF    141 - 210
SSIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQATEILNEYFYSHLSNPYPSEEAKEELAKKCSITVS    211 - 280
QVSNWFGNKRIRYKKNIGKFQEEANLYAAKTAVTAAHAVAAAVQNNQTNSPTTPNSGSSGSFNLPNSGDM    281 - 350
FMNMQSLNGDSYQGSQVGANVQSQVDTLRHVINQTGGYSDGLGGNSLYSPHNLNANGGWQDATTPSSVTS    351 - 420
PTEGPGSVHSDTSN                                                            421 - 434
//

Text Mined References (40)

PMID Year Title