Property Summary

NCBI Gene PubMed Count 32
Grant Count 32
R01 Count 28
Funding $2,182,142.75
PubMed Score 26.75
PubTator Score 20.88

Knowledge Summary

Patent

No data available

Expression

Gene RIF (17)

PMID Text
26747896 Studies implicate PBX3/MEIS1 interaction as a driver of cell transformation and leukemogenesis, and that this axis may play a critical role in the regulation of the core transcriptional programs activated in MLL-rearranged and HOX-overexpressing AML.
26420065 let-7c, miR-200b, miR-222 and miR-424 target PBX3, which is necessary for the acquisition and maintenance of liver tumour-initiating cells properties.
26130510 Pbx3 contributes to Hoxa9 leukemogenesis through stabilization of the Meis1 protein.
25561793 PBX3 induces invasion and metastasis of colorectal caner cells partially through activation of the MAPK/ERK signaling pathway.
25266220 we report a novel hypomethylation pattern, specific to CBFB-MYH11 fusion resulting from inv(16) rearrangement in acute myeloid leukemia the expression of which correlated with PBX3 differential methylation
24375258 matrigel invasion assay showed that PBX3 transfection also increased cell-invading ability
23539541 An intermediate-risk group of acute myeloid leukemia patients compared to a group with a favorable risk reduces to a four-gene signature of HOXA6, HOXA9, PBX3 and MEIS1 by iterative analysis of independent platforms.
23264595 Collectively, our data suggest that PBX3 is a critical cofactor of HOXA9 in leukemogenesis.
23161775 Increased expression of PBX3 is associated with pilocytic astrocytoma.
22426282 The Pbx3 Ala136Val variant is a modifier or risk allele for congenital heart defects.
More...

AA Sequence

MDDQSRMLQTLAGVNLAGHSVQGGMALPPPPHGHEGADGDGRKQDIGDILHQIMTITDQSLDEAQAKKHA      1 - 70
LNCHRMKPALFSVLCEIKEKTGLSIRGAQEEDPPDPQLMRLDNMLLAEGVSGPEKGGGSAAAAAAAAASG     71 - 140
GSSDNSIEHSDYRAKLTQIRQIYHTELEKYEQACNEFTTHVMNLLREQSRTRPISPKEIERMVGIIHRKF    141 - 210
SSIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQATEILNEYFYSHLSNPYPSEEAKEELAKKCSITVS    211 - 280
QVSNWFGNKRIRYKKNIGKFQEEANLYAAKTAVTAAHAVAAAVQNNQTNSPTTPNSGSSGSFNLPNSGDM    281 - 350
FMNMQSLNGDSYQGSQVGANVQSQVDTLRHVINQTGGYSDGLGGNSLYSPHNLNANGGWQDATTPSSVTS    351 - 420
PTEGPGSVHSDTSN                                                            421 - 434
//

Text Mined References (35)

PMID Year Title
26747896 2016 PBX3 and MEIS1 Cooperate in Hematopoietic Cells to Drive Acute Myeloid Leukemias Characterized by a Core Transcriptome of the MLL-Rearranged Disease.
26420065 2015 PBX3 is targeted by multiple miRNAs and is essential for liver tumour-initiating cells.
26130510 2015 Dangerous liaisons: cooperation between Pbx3, Meis1 and Hoxa9 in leukemia.
25561793 2014 PBX3 promotes migration and invasion of colorectal cancer cells via activation of MAPK/ERK signaling pathway.
25266220 2014 CBFB-MYH11 hypomethylation signature and PBX3 differential methylation revealed by targeted bisulfite sequencing in patients with acute myeloid leukemia.
24375258 2014 PBX3 is overexpressed in gastric cancer and regulates cell proliferation.
24009623 2013 Genome-wide association study for biomarker identification of Rapamycin and Everolimus using a lymphoblastoid cell line system.
23539541 2013 HOXA/PBX3 knockdown impairs growth and sensitizes cytogenetically normal acute myeloid leukemia cells to chemotherapy.
23264595 2013 PBX3 is an important cofactor of HOXA9 in leukemogenesis.
23161775 2013 MicroRNA profiling in pediatric pilocytic astrocytoma reveals biologically relevant targets, including PBX3, NFIB, and METAP2.
More...