Property Summary

NCBI Gene PubMed Count 36
PubMed Score 75.66
PubTator Score 46.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... -1.200 1.2e-03
malignant mesothelioma 1.400 1.1e-06
medulloblastoma, large-cell -1.100 1.4e-03
osteosarcoma -1.391 1.8e-04
psoriasis -1.700 5.6e-04

Gene RIF (16)

AA Sequence

MDERLLGPPPPGGGRGGLGLVSGEPGGPGEPPGGGDPGGGSGGVPGGRGKQDIGDILQQIMTITDQSLDE      1 - 70
AQAKKHALNCHRMKPALFSVLCEIKEKTGLSIRSSQEEEPVDPQLMRLDNMLLAEGVAGPEKGGGSAAAA     71 - 140
AAAAASGGGVSPDNSIEHSDYRSKLAQIRHIYHSELEKYEQACNEFTTHVMNLLREQSRTRPVAPKEMER    141 - 210
MVSIIHRKFSAIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQATEVLNEYFYSHLSNPYPSEEAKEEL    211 - 280
AKKCGITVSQVSNWFGNKRIRYKKNIGKFQEEANIYAVKTAVSVTQGGHSRTSSPTPPSSAGSGGSFNLS    281 - 350
GSGDMFLGMPGLNGDSYSASQVESLRHSMGPGGYGDNLGGGQMYSPREMRANGSWQEAVTPSSVTSPTEG    351 - 420
PGSVHSDTSN                                                                421 - 430
//

Text Mined References (45)

PMID Year Title