Property Summary

NCBI Gene PubMed Count 100
PubMed Score 200.05
PubTator Score 123.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
active ulcerative colitis -1.104 4.8e-02
acute myeloid leukemia -3.000 4.8e-02
adrenocortical carcinoma -1.016 2.1e-02
adult high grade glioma -1.100 1.1e-02
Breast cancer 1.400 7.3e-09
breast carcinoma 1.500 1.3e-03
colon cancer -1.300 1.5e-02
cystic fibrosis 1.468 6.9e-06
glioblastoma 1.100 1.3e-02
group 4 medulloblastoma -1.200 6.0e-04
interstitial cystitis -1.200 1.1e-02
intraductal papillary-mucinous carcinoma... -1.200 2.7e-03
lung adenocarcinoma -1.100 5.1e-13
lung cancer -1.400 3.9e-03
malignant mesothelioma -3.100 4.0e-08
non-small cell lung cancer -1.003 9.8e-09
osteosarcoma 1.735 3.1e-03
ovarian cancer -1.600 2.4e-04
pancreatic cancer -1.700 2.9e-03
pituitary cancer 1.500 4.7e-05
primary pancreatic ductal adenocarcinoma -1.670 3.3e-03

Protein-protein Interaction (1)

Gene RIF (64)

AA Sequence

MDEQPRLMHSHAGVGMAGHPGLSQHLQDGAGGTEGEGGRKQDIGDILQQIMTITDQSLDEAQARKHALNC      1 - 70
HRMKPALFNVLCEIKEKTVLSIRGAQEEEPTDPQLMRLDNMLLAEGVAGPEKGGGSAAAAAAAAASGGAG     71 - 140
SDNSVEHSDYRAKLSQIRQIYHTELEKYEQACNEFTTHVMNLLREQSRTRPISPKEIERMVSIIHRKFSS    141 - 210
IQMQLKQSTCEAVMILRSRFLDARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQV    211 - 280
SNWFGNKRIRYKKNIGKFQEEANIYAAKTAVTATNVSAHGSQANSPSTPNSAGSSSSFNMSNSGDLFMSV    281 - 350
QSLNGDSYQGAQVGANVQSQVDTLRHVISQTGGYSDGLAASQMYSPQGISANGGWQDATTPSSVTSPTEG    351 - 420
PGSVHSDTSN                                                                421 - 430
//

Text Mined References (103)

PMID Year Title