Property Summary

NCBI Gene PubMed Count 89
PubMed Score 188.50
PubTator Score 123.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Disease Target Count P-value
group 4 medulloblastoma 1875 3.69258613110696E-10
malignant mesothelioma 3163 2.6465677805739E-9
lung adenocarcinoma 2714 2.85012128601246E-9
Breast cancer 3099 7.2895173430534E-9
non-small cell lung cancer 2798 9.76837491340005E-9
cystic fibrosis 1670 1.09657908429474E-6
ovarian cancer 8492 1.48875485205915E-6
pituitary cancer 1972 4.6898280378294E-5
breast carcinoma 1614 0.00126592992625617
pancreatic cancer 2300 0.00293452421083685
osteosarcoma 7933 0.00311087084935423
primary pancreatic ductal adenocarcinoma 1271 0.00325475800008722
lung cancer 4473 0.00391979030560649
ulcerative colitis 2087 0.00682635721400652
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00968602585542541
interstitial cystitis 2299 0.0105494365063551
adult high grade glioma 2148 0.0113817958426177
glioblastoma 5572 0.0130436281890654
adrenocortical carcinoma 1427 0.0205516435709031
colon cancer 1475 0.0238866744948525
acute myeloid leukemia 785 0.0484554478941503
Disease Target Count Z-score Confidence
Acquired metabolic disease 267 0.0 1.0
Disease Target Count Z-score Confidence
Cancer 2346 0.0 4.0
Disease Target Count Z-score Confidence
Leukemia 88 5.588 2.8
Myoepithelioma 12 3.753 1.9
Disease Target Count
Burkitt Lymphoma 19

Expression

  Differential Expression (21)

Disease log2 FC p
malignant mesothelioma -6.600 0.000
osteosarcoma 1.735 0.003
group 4 medulloblastoma -3.300 0.000
cystic fibrosis 2.804 0.000
glioblastoma 1.100 0.013
adrenocortical carcinoma -1.016 0.021
primary pancreatic ductal adenocarcinoma -1.670 0.003
non-small cell lung cancer -1.003 0.000
intraductal papillary-mucinous carcinoma... -2.200 0.010
lung cancer -1.400 0.004
colon cancer -1.600 0.024
ulcerative colitis -1.300 0.007
breast carcinoma 1.500 0.001
interstitial cystitis -1.200 0.011
lung adenocarcinoma -2.000 0.000
adult high grade glioma -1.100 0.011
Breast cancer 1.400 0.000
acute myeloid leukemia -3.000 0.048
ovarian cancer -1.900 0.000
pituitary cancer 1.500 0.000
pancreatic cancer -1.700 0.003

Synonym

Accession P40424 B4DSC1 F5H4U9 Q5T488
Symbols

Gene

PDB

1B72   1PUF  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG
Platypus OMA EggNOG
Chicken OMA Inparanoid

Gene RIF (55)

PMID Text
26971355 This study thus suggests that RNF6 overexpression in leukemia is under the direction of PBX1 and that the PBX1/RNF6 axis can be developed as a novel therapeutic target of leukemia.
26671461 PBX1 promotes frontal cortex patterning by repressing genes that promote dorsocaudal fate.
26237075 We observed significant enrichment of the neuroactive ligand-receptor interaction pathway in TCF3-PBX1 as well as an enrichment of genes involved in immunity and infection pathways in ETV6-RUNX1 subtype
26215677 Data identifies PBX1 amplification as a functional hallmark of aggressive ERalpha-positive breast cancers.
26211905 Hematopoietic pre-B cell leukemia transcription factor interacting protein enhances gastric cancer cell migration and invasion, and modulates epithelial-mesenchymal transition, which plays a key role in cancer cell migration and invasion.
26075712 This association study successfully identified two susceptibility Single Nucleotide Polymorphisms, (WNT9B and PBX1) associated with Mayer-Rokitansky-Kuster-Hauser syndrome risk, both separately and interactively.
25551271 When intensive chemotherapy was used, the TCF3-PBX1 was associated with a favorable outcome in childhood pre-B ALL.
24947929 Induction of PBX1 expression was associated with 13-cisRA responsiveness in neuroblastoma.
24578304 In this study, we showed that TCF3-PBX1 positive pediatric BCP-ALL patients treated according to the JACLS ALL02 and CCLSG ALL2004 protocol had favorable outcomes
23688269 E2A-PBX1 fusion gene caused by t(1;19)(q23;p13) may be a common genetic change in AIS and a survival determinant for female AIS patients at early stage.
More...

AA Sequence

MDEQPRLMHSHAGVGMAGHPGLSQHLQDGAGGTEGEGGRKQDIGDILQQIMTITDQSLDEAQARKHALNC      1 - 70
HRMKPALFNVLCEIKEKTVLSIRGAQEEEPTDPQLMRLDNMLLAEGVAGPEKGGGSAAAAAAAAASGGAG     71 - 140
SDNSVEHSDYRAKLSQIRQIYHTELEKYEQACNEFTTHVMNLLREQSRTRPISPKEIERMVSIIHRKFSS    141 - 210
IQMQLKQSTCEAVMILRSRFLDARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQV    211 - 280
SNWFGNKRIRYKKNIGKFQEEANIYAAKTAVTATNVSAHGSQANSPSTPNSAGSSSSFNMSNSGDLFMSV    281 - 350
QSLNGDSYQGAQVGANVQSQVDTLRHVISQTGGYSDGLAASQMYSPQGISANGGWQDATTPSSVTSPTEG    351 - 420
PGSVHSDTSN                                                                421 - 430
//

Text Mined References (92)

PMID Year Title
26971355 2016 The Ring Finger Protein RNF6 Induces Leukemia Cell Proliferation as a Direct Target of Pre-B-cell Leukemia Homeobox 1.
26671461 2015 Pbx Regulates Patterning of the Cerebral Cortex in Progenitors and Postmitotic Neurons.
26237075 2015 Epigenetic landscape correlates with genetic subtype but does not predict outcome in childhood acute lymphoblastic leukemia.
26215677 2015 The pioneer factor PBX1 is a novel driver of metastatic progression in ER?-positive breast cancer.
26211905 2015 Hematopoietic pre-B cell leukemia transcription factor interacting protein is overexpressed in gastric cancer and promotes gastric cancer cell proliferation, migration, and invasion.
26075712 2015 Associations of Polymorphisms in WNT9B and PBX1 with Mayer-Rokitansky-Küster-Hauser Syndrome in Chinese Han.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25551271 2015 Clinical features and prognostic significance of TCF3-PBX1 fusion gene in Chinese children with acute lymphoblastic leukemia by using a modified ALL-BFM-95 protocol.
24947929 2014 PBX1 is a favorable prognostic biomarker as it modulates 13-cis retinoic acid-mediated differentiation in neuroblastoma.
24709693 2014 Genome-wide data reveal novel genes for methotrexate response in a large cohort of juvenile idiopathic arthritis cases.
More...