Property Summary

Ligand Count 1
NCBI Gene PubMed Count 51
PubMed Score 159.00
PubTator Score 125.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
esophageal adenocarcinoma -2.700 2.5e-02
head and neck cancer -1.300 2.8e-02
head and neck cancer and chronic obstruc... -1.700 3.4e-04
nasopharyngeal carcinoma -2.500 1.5e-08
non-small cell lung cancer 2.255 4.6e-08
psoriasis 3.200 1.1e-116

Gene RIF (31)

AA Sequence

MFAEIQIQDKDRMGTAGKVIKCKAAVLWEQKQPFSIEEIEVAPPKTKEVRIKILATGICRTDDHVIKGTM      1 - 70
VSKFPVIVGHEATGIVESIGEGVTTVKPGDKVIPLFLPQCRECNACRNPDGNLCIRSDITGRGVLADGTT     71 - 140
RFTCKGKPVHHFMNTSTFTEYTVVDESSVAKIDDAAPPEKVCLIGCGFSTGYGAAVKTGKVKPGSTCVVF    141 - 210
GLGGVGLSVIMGCKSAGASRIIGIDLNKDKFEKAMAVGATECISPKDSTKPISEVLSEMTGNNVGYTFEV    211 - 280
IGHLETMIDALASCHMNYGTSVVVGVPPSAKMLTYDPMLLFTGRTWKGCVFGGLKSRDDVPKLVTEFLAK    281 - 350
KFDLDQLITHVLPFKKISEGFELLNSGQSIRTVLTF                                      351 - 386
//

Text Mined References (55)

PMID Year Title