Property Summary

NCBI Gene PubMed Count 51
Grant Count 20
R01 Count 3
Funding $1,933,752.09
PubMed Score 154.46
PubTator Score 125.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
esophageal adenocarcinoma -2.700 0.025
non-small cell lung cancer 2.255 0.000
nasopharyngeal carcinoma -2.500 0.000
head and neck cancer -1.300 0.028
head and neck cancer and chronic obstruc... -1.700 0.000
psoriasis 3.200 0.000

Gene RIF (31)

PMID Text
25527893 These results suggest that variants near ADH7 may play a role in protection from alcohol dependence in this Mexican American cohort.
24722735 ADH1B-ADH1C-ADH7 cluster SNPs confer susceptibility to esophageal squamous cell carcinoma
24512552 Transcriptional regulatory elements of ADH7 were identified that effect gene expression.
23468174 common ADH1-7 variants conferred risk for both schizophrenia in African-Americans and autism in European-Americans.
23149980 The rs1573496 (ADH7) polymorphism was not associated with colorectal cancer risk overall in Western-European populations. However, the relationship between alcohol and colorectal cancer risk might be modulated by the rs1573496 (ADH7) polymorphism.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20700531 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20336794 The current results support the ADH7 A92G SNP as a marker for the risk of SCCHN in non-Hispanic white populations.
20336794 Observational study of gene-disease association. (HuGE Navigator)
20158305 An association between age at onset of regular alcohol use and a SNP just upstream of ADH7 (rs2654849, p = .003) was observed.
More...

AA Sequence

MFAEIQIQDKDRMGTAGKVIKCKAAVLWEQKQPFSIEEIEVAPPKTKEVRIKILATGICRTDDHVIKGTM      1 - 70
VSKFPVIVGHEATGIVESIGEGVTTVKPGDKVIPLFLPQCRECNACRNPDGNLCIRSDITGRGVLADGTT     71 - 140
RFTCKGKPVHHFMNTSTFTEYTVVDESSVAKIDDAAPPEKVCLIGCGFSTGYGAAVKTGKVKPGSTCVVF    141 - 210
GLGGVGLSVIMGCKSAGASRIIGIDLNKDKFEKAMAVGATECISPKDSTKPISEVLSEMTGNNVGYTFEV    211 - 280
IGHLETMIDALASCHMNYGTSVVVGVPPSAKMLTYDPMLLFTGRTWKGCVFGGLKSRDDVPKLVTEFLAK    281 - 350
KFDLDQLITHVLPFKKISEGFELLNSGQSIRTVLTF                                      351 - 386
//

Text Mined References (55)

PMID Year Title
25527893 2014 Protective variant associated with alcohol dependence in a Mexican American cohort.
24722735 2014 Replication study of ESCC susceptibility genetic polymorphisms locating in the ADH1B-ADH1C-ADH7 cluster identified by GWAS.
24512552 2014 Single-nucleotide polymorphisms interact to affect ADH7 transcription.
23568457 2013 Genetic variants associated with disordered eating.
23468174 2013 Association between common alcohol dehydrogenase gene (ADH) variants and schizophrenia and autism.
23456092 2013 Extended genetic effects of ADH cluster genes on the risk of alcohol dependence: from GWAS to replication.
23149980 2012 Alcohol dehydrogenase and aldehyde dehydrogenase gene polymorphisms, alcohol intake and the risk of colorectal cancer in the European Prospective Investigation into Cancer and Nutrition study.
21437268 2011 A genome-wide association study of upper aerodigestive tract cancers conducted within the INHANCE consortium.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20700531 2010 The association of alcohol and alcohol metabolizing gene variants with diabetes and coronary heart disease risk factors in a white population.
More...